SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8NFU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8NFU0
Sequence length 473
Comment (sp|Q8NFU0|BEST4_HUMAN) Vitelliform macular dystrophy 2-like protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=BEST4; OC=Catarrhini; Hominidae; Homo.
Sequence
MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITYRLLLTQEQRY
VYAQVARYCNRSADLIPLSFVLGFYVTLVVNRWWSQYTSIPLPDQLMCVISASVHGVDQR
GRLLRRTLIRYANLASVLVLRSVSTRVLKRFPTMEHVVDAGFMSQEERKKFESLKSDFNK
YWVPCVWFTNLAAQARRDGRIRDDIALCLLLEELNKYRAKCSMLFHYDWISIPLVYTQVV
TIAVYSFFALSLVGRQFVEPEAGAAKPQKLLKPGQEPAPALGDPDMYVPLTTLLQFFFYA
GWLKVAEQIINPFGEDDDDFETNQLIDRNLQVSLLSVDEMYQNLPPAEKDQYWDEDQPQP
PYTVATAAESLRPSFLGSTFNLRMSDDPEQSLQVEASPGSGRPAPAAQTPLLGRFLGVGA
PSPAISLRNFGRVRGTPRPPHLLRFRAEEGGDPEAAARIEEESAESGDEALEP
Download sequence
Identical sequences G3QS90 H2PYW4 Q8NFU0
ENSP00000361281 ENSP00000361281 NP_695006.1.87134 NP_695006.1.92137 XP_004025718.1.27298 XP_016816927.1.37143 XP_016856511.1.92137 XP_016856512.1.92137 XP_018872855.1.27298 XP_018872863.1.27298 ENSGGOP00000005520 ENSPTRP00000001148 gi|23397576|ref|NP_695006.1| 9598.ENSPTRP00000001148 9606.ENSP00000361281 ENSPTRP00000001148 ENSGGOP00000005520 ENSP00000361281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]