SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8NG41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8NG41
Sequence length 125
Comment (sp|Q8NG41|NPB_HUMAN) Neuropeptide B-29 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NPB; OC=Catarrhini; Hominidae; Homo.
Sequence
MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYR
GAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAA
DCLAA
Download sequence
Identical sequences Q8NG41
ENSP00000332766 NP_683694.1.87134 NP_683694.1.92137 9606.ENSP00000332766 ENSP00000332766 gi|22507403|ref|NP_683694.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]