SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8NGA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8NGA6
Domain Number 1 Region: 1-311
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.33e-77
Family Rhodopsin-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8NGA6
Sequence length 315
Comment (sp|Q8NGA6|O10H5_HUMAN) Olfactory receptor OR19-26 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OR10H5; OC=Catarrhini; Hominidae; Homo.
Sequence
MQGLNHTSVSEFILVGFSAFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHMPMY
LFLCALSITEILYTVAIIPRMLADLLSTQRSIAFLACASQMFFSFSFGFTHSFLLTVMGY
DRYVAICHPLRYNVLMSLRGCTCRVGCSWAGGLVMGMVVTSAIFHLAFCGHKEIHHFFCH
VPPLLKLACGDDVLVVAKGVGLVCITALLGCFLLILLSYAFIVAAILKIPSAEGRNKAFS
TCASHLTVVVVHYGFASVIYLKPKGPQSPEGDTLMGITYTVLTPFLSPIIFSLRNKELKV
AMKKTCFTKLFPQNC
Download sequence
Identical sequences A0A126GWE9 Q8NGA6
ENSP00000310704 gi|52218844|ref|NP_001004466.1| ENSP00000310704 9606.ENSP00000310704 NP_001004466.1.87134 NP_001004466.1.92137 ENSP00000310704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]