SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8NGF9 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8NGF9
Domain Number 1 Region: 2-298
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.58e-74
Family Rhodopsin-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.428 73.38
cilium 1.675 18.22
ciliary part 1.819 15.9
receptor complex 1.469 9.53
cell body 1.534 9.34
endosome 1.351 7.79
membrane region 1.565 6.09
membrane raft 2.03 6.09
dendrite 1.582 5.8
organelle envelope 1.405 5.73

Protein sequence

External link(s) Q8NGF9
Sequence length 303
Comment (sp|Q8NGF9|OR4X2_HUMAN) Olfactory receptor OR11-105 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OR4X2; OC=Catarrhini; Hominidae; Homo.
Sequence
MTEFIFLVLSPNQEVQRVCFVIFLFLYTAIVLGNFLIVLTVMTSRSLGSPMYFFLSYLSF
MEICYSSATAPKLISDLLAERKVISWWGCMAQLFFLHFFGGTEIFLLTVMAYDHYVAICK
PLSYTTIMNWQVCTVLVGIAWVGGFMHSFAQILLIFHLLFCGPNVINHYFCDLVPLLKLA
CSDTFLIGLLIVANGGTLSVISFGVLLASYMVILLHLRTWSSEGWCKALSTCGSHFAVVI
LFFGPCVFNSLRPSTTLPIDKMVAVFYTVITAILNPVIYSLRNAEMRKAMKRLWIRTLRL
NEK
Download sequence
Identical sequences A0A126GVL5 Q8NGF9
ENSP00000307751 ENSP00000307751 ENSP00000307751 9606.ENSP00000307751 gi|52317106|ref|NP_001004727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]