SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8NGN5 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8NGN5
Domain Number 1 Region: 1-301
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.11e-79
Family Rhodopsin-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.428 73.38
cilium 1.675 18.22
ciliary part 1.819 15.9
receptor complex 1.469 9.53
cell body 1.534 9.34
endosome 1.351 7.79
membrane region 1.565 6.09
membrane raft 2.03 6.09
dendrite 1.582 5.8
organelle envelope 1.405 5.73

Protein sequence

External link(s) Q8NGN5
Sequence length 311
Comment (sp|Q8NGN5|O10G8_HUMAN) Olfactory receptor OR11-282 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OR10G8; OC=Catarrhini; Hominidae; Homo.
Sequence
MSNASLLTAFILMGLPHAPALDAPLFGVFLVVYVLTVLGNLLILLVIRVDSHLHTTMYYF
LTNLSFIDMWFSTVTVPKLLMTLVFPSGRAISFHSCMAQLYFFHFLGGTECFLYRVMSCD
RYLAISYPLRYTSMMTGRSCTLLATSTWLSGSLHSAVQAILTFHLPYCGPNWIQHYLCDA
PPILKLACADTSAIETVIFVTVGIVASGCFVLIVLSYVSIVCSILRIRTSEGKHRAFQTC
ASHCIVVLCFFGPGLFIYLRPGSRKAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLK
LKDKVAHSQSK
Download sequence
Identical sequences A0A126GVX3 Q8NGN5
ENSP00000389072 ENSP00000389072 ENSP00000389072 gi|52218840|ref|NP_001004464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]