SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8NGT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8NGT0
Domain Number 1 Region: 1-316
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.4e-87
Family Rhodopsin-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8NGT0
Sequence length 318
Comment (sp|Q8NGT0|O13C9_HUMAN) Olfactory receptor OR9-13 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OR13C9; OC=Catarrhini; Hominidae; Homo.
Sequence
MEWENQTILVEFFLKGHSVHPRLELLFFVLIFIMYVVILLGNGTLILISILDPHLHTPMY
FFLGNLSFLDICYTTTSIPSTLVSFLSERKTISFSGCAVQMFLGLAMGTTECVLLGMMAF
DRYVAICNPLRYPIIMSKNAYVPMAVGSWFAGIVNSAVQTTFVVQLPFCRKNVINHFSCE
ILAVMKLACADISGNEFLMLVATILFTLMPLLLIVISYSLIISSILKIHSSEGRSKAFST
CSAHLTVVIIFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLRN
KDVKEAVKHLPNRRFFSK
Download sequence
Identical sequences Q8NGT0
ENSP00000259362 9606.ENSP00000259362 gi|50080197|ref|NP_001001956.1| NP_001001956.1.87134 NP_001001956.1.92137 ENSP00000259362 ENSP00000259362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]