SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8TAP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8TAP4
Domain Number 1 Region: 74-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000258
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 38-70
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000441
Family LIM domain 0.0034
Further Details:      
 
Domain Number 3 Region: 8-38
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000318
Family LIM domain 0.0091
Further Details:      
 
Weak hits

Sequence:  Q8TAP4
Domain Number - Region: 104-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00428
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8TAP4
Sequence length 145
Comment (sp|Q8TAP4|LMO3_HUMAN) Rhombotin-3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=LMO3; OC=Catarrhini; Hominidae; Homo.
Sequence
MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANL
ILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFL
KNNMILCQTDYEEGLMKEGYAPQVR
Download sequence
Identical sequences A0A024RAT1 A0A1D5PCN3 A0A1S3FVY3 A0A1S3WH25 A0A1U7SMD6 A0A1U7UCJ4 A0A1U8BXN9 A0A1W5AEK5 A0A218V983 A0A2I0LXY2 A0A2I3TJK0 A0A2J8T1T8 A0A2K5INZ9 A0A2K5LAS4 A0A2K5QKH8 A0A2K5UMH1 A0A2K6A358 A0A2K6D8B3 A0A2K6K039 A0A2K6P7F9 A0A2K6S3V7 A9ED84 F7HY30 G1QDQ3 G3S5W0 G3W2X5 H9EM92 I3N9J5 J9P4K0 M0R4L0 Q2KIA3 Q5RBW7 Q8BZL8 Q8TAP4 W5QHA7
ENSP00000312856 ENSP00000346689 ENSP00000412479 ENSP00000413703 ENSP00000439275 ENSP00000440099 ENSP00000444393 ENSP00000445751 ENSP00000446115 ENSSHAP00000009780 ENSSSCP00000000627 ENSCAFP00000040479 ENSPTRP00000008089 ENSPPYP00000004954 ENSSTOP00000005264 NP_001001395.1.87134 NP_001001395.1.92137 NP_001039802.1.59421 NP_001039802.1.76553 NP_001106155.1.46622 NP_001125415.1.23681 NP_001127650.2.23681 NP_001230538.1.87134 NP_001230538.1.92137 NP_001230539.1.87134 NP_001230539.1.92137 NP_001253235.1.72884 NP_061110.2.87134 NP_061110.2.92137 NP_997105.1.92730 XP_001366731.2.35504 XP_002196644.1.42559 XP_002752237.1.60252 XP_002752240.1.60252 XP_003226003.1.98722 XP_003265607.1.23891 XP_003265609.1.23891 XP_003265610.1.23891 XP_003265613.1.23891 XP_003265614.1.23891 XP_003265615.1.23891 XP_003313574.1.37143 XP_003313575.1.37143 XP_003313576.1.37143 XP_003313577.1.37143 XP_003749911.1.100692 XP_003952174.1.37143 XP_004052861.1.27298 XP_004052862.1.27298 XP_004052863.1.27298 XP_004052864.1.27298 XP_004052865.1.27298 XP_004092147.1.23891 XP_004092148.1.23891 XP_004174330.1.42559 XP_004390869.1.4749 XP_004390870.1.4749 XP_004390871.1.4749 XP_004390872.1.4749 XP_004407024.1.74151 XP_004407026.1.74151 XP_004407027.1.74151 XP_004407028.1.74151 XP_004435474.1.5094 XP_004435475.1.5094 XP_004460354.1.11602 XP_004460355.1.11602 XP_004460356.1.11602 XP_004592651.1.84141 XP_004592652.1.84141 XP_004592653.1.84141 XP_004592654.1.84141 XP_004592655.1.84141 XP_004611346.1.94378 XP_004611347.1.94378 XP_004626159.1.9945 XP_004626160.1.9945 XP_004664505.1.11716 XP_004664506.1.11716 XP_004713832.1.18182 XP_004755807.1.14098 XP_004755808.1.14098 XP_004755809.1.14098 XP_004755810.1.14098 XP_004755811.1.14098 XP_004755812.1.14098 XP_004755813.1.14098 XP_004755814.1.14098 XP_004845864.1.39548 XP_004845865.1.39548 XP_004845866.1.39548 XP_004845867.1.39548 XP_004845868.1.39548 XP_004845869.1.39548 XP_004845870.1.39548 XP_004938022.1.86415 XP_004938023.1.86415 XP_005003875.1.53824 XP_005003876.1.53824 XP_005017134.1.99704 XP_005040449.1.66865 XP_005040450.1.66865 XP_005040451.1.66865 XP_005040452.1.66865 XP_005148202.1.78019 XP_005148203.1.78019 XP_005148204.1.78019 XP_005207039.1.76553 XP_005233864.1.75256 XP_005233865.1.75256 XP_005233866.1.75256 XP_005379085.1.28644 XP_005379086.1.28644 XP_005379087.1.28644 XP_005379088.1.28644 XP_005379089.1.28644 XP_005379090.1.28644 XP_005379091.1.28644 XP_005425363.1.5688 XP_005425364.1.5688 XP_005440879.1.10750 XP_005440880.1.10750 XP_005440881.1.10750 XP_005481916.1.73095 XP_005481917.1.73095 XP_005481918.1.73095 XP_005510781.1.63277 XP_005510782.1.63277 XP_005510783.1.63277 XP_005510784.1.63277 XP_005527023.1.90289 XP_005527024.1.90289 XP_005570315.1.63531 XP_005570316.1.63531 XP_005637155.1.84170 XP_005637156.1.84170 XP_005637157.1.84170 XP_005637158.1.84170 XP_005637159.1.84170 XP_005637160.1.84170 XP_005664103.1.46622 XP_005866827.1.60319 XP_005866828.1.60319 XP_005866829.1.60319 XP_005866830.1.60319 XP_005907501.1.15283 XP_005907502.1.15283 XP_005907503.1.15283 XP_005954899.1.78601 XP_006011094.1.90931 XP_006034411.1.24877 XP_006034412.1.24877 XP_006034413.1.24877 XP_006034414.1.24877 XP_006034416.1.24877 XP_006034417.1.24877 XP_006084362.1.53796 XP_006084363.1.53796 XP_006084364.1.53796 XP_006084365.1.53796 XP_006167383.1.99106 XP_006167384.1.99106 XP_006167385.1.99106 XP_006167386.1.99106 XP_006199967.1.17985 XP_006199970.1.17985 XP_006237650.1.100692 XP_006237652.1.100692 XP_006237653.1.100692 XP_006273899.1.47583 XP_006505403.1.92730 XP_006505404.1.92730 XP_006505405.1.92730 XP_006505407.1.92730 XP_006719173.1.92137 XP_006719174.1.92137 XP_006866084.1.41390 XP_006888501.1.29581 XP_006888502.1.29581 XP_006912724.1.64745 XP_006933606.1.62641 XP_006933608.1.62641 XP_006976558.1.50099 XP_007082796.1.5354 XP_007082797.1.5354 XP_007082798.1.5354 XP_007082799.1.5354 XP_007082800.1.5354 XP_007100462.1.24612 XP_007194872.1.59432 XP_007438988.1.37977 XP_007503658.1.35504 XP_007503659.1.35504 XP_007503660.1.35504 XP_007503661.1.35504 XP_007527678.1.11023 XP_007942638.1.48129 XP_007942640.1.48129 XP_007965974.1.81039 XP_007965975.1.81039 XP_007965976.1.81039 XP_007965977.1.81039 XP_008062972.1.4292 XP_008062977.1.4292 XP_008116820.1.98722 XP_008116821.1.98722 XP_008138681.1.99482 XP_008138682.1.99482 XP_008504148.1.100939 XP_008504149.1.100939 XP_008504150.1.100939 XP_008504151.1.100939 XP_008533218.1.77740 XP_008533219.1.77740 XP_008533220.1.77740 XP_008581753.1.73410 XP_008581754.1.73410 XP_008581755.1.73410 XP_008581756.1.73410 XP_008581757.1.73410 XP_008642239.1.15636 XP_008642241.1.15636 XP_008705281.1.72690 XP_008705282.1.72690 XP_008761675.1.100692 XP_008831579.1.79516 XP_008831580.1.79516 XP_008831581.1.79516 XP_008831582.1.79516 XP_008831583.1.79516 XP_008831584.1.79516 XP_008831585.1.79516 XP_008933020.1.96775 XP_008933021.1.51550 XP_008933021.1.96775 XP_008933022.1.51550 XP_008933022.1.96775 XP_008934092.1.37566 XP_008967818.1.60992 XP_008967819.1.60992 XP_008967820.1.60992 XP_008967821.1.60992 XP_008967822.1.60992 XP_008967823.1.60992 XP_008967824.1.60992 XP_009001515.1.60252 XP_009001516.1.60252 XP_009001521.1.60252 XP_009001522.1.60252 XP_009001523.1.60252 XP_009083092.1.14518 XP_009093410.1.15306 XP_009093411.1.15306 XP_009245794.1.23681 XP_009245795.1.23681 XP_009277266.1.47732 XP_009331122.1.49731 XP_009423199.1.37143 XP_009423200.1.37143 XP_009423201.1.37143 XP_009423202.1.37143 XP_009469305.1.38621 XP_009469306.1.38621 XP_009469308.1.38621 XP_009478007.1.14425 XP_009503916.1.22320 XP_009568937.1.62272 XP_009568938.1.62272 XP_009568940.1.62272 XP_009647022.1.23211 XP_009647023.1.23211 XP_009670231.1.43253 XP_009670232.1.43253 XP_009670233.1.43253 XP_009670234.1.43253 XP_009701200.1.71050 XP_009874620.1.31609 XP_009877954.1.48241 XP_009877955.1.48241 XP_009877956.1.48241 XP_009901101.1.92783 XP_009901102.1.92783 XP_009941301.1.35112 XP_009941302.1.35112 XP_009954826.1.99599 XP_010001242.1.85724 XP_010001243.1.85724 XP_010001244.1.85724 XP_010015775.1.70042 XP_010083766.1.40768 XP_010118127.1.88979 XP_010141365.1.100080 XP_010156874.1.22856 XP_010160708.1.30499 XP_010224138.1.20684 XP_010224139.1.20684 XP_010224140.1.20684 XP_010224141.1.20684 XP_010289702.1.48707 XP_010343426.1.74449 XP_010343427.1.74449 XP_010343429.1.74449 XP_010343430.1.74449 XP_010343431.1.74449 XP_010374038.1.97406 XP_010402487.1.2935 XP_010402488.1.2935 XP_010564417.1.12557 XP_010564418.1.12557 XP_010564419.1.12557 XP_010614273.1.5607 XP_010614281.1.5607 XP_010803756.1.76553 XP_010803757.1.76553 XP_010803758.1.76553 XP_010857050.1.44457 XP_010857051.1.44457 XP_010857052.1.44457 XP_010857053.1.44457 XP_010944787.1.22495 XP_010944788.1.22495 XP_010944789.1.22495 XP_010987156.1.51371 XP_010987157.1.51371 XP_010987158.1.51371 XP_010987159.1.51371 XP_011222596.1.58354 XP_011239433.1.92730 XP_011239434.1.92730 XP_011239435.1.92730 XP_011371242.1.92234 XP_011371243.1.92234 XP_011371244.1.92234 XP_011519064.1.92137 XP_011519065.1.92137 XP_011574884.1.59079 XP_011574885.1.59079 XP_011574886.1.59079 XP_011574888.1.59079 XP_011574889.1.59079 XP_011739455.1.29376 XP_011739462.1.29376 XP_011739469.1.29376 XP_011739479.1.29376 XP_011739486.1.29376 XP_011739489.1.29376 XP_011739498.1.29376 XP_011739506.1.29376 XP_011809964.1.43180 XP_011809971.1.43180 XP_011809980.1.43180 XP_011809989.1.43180 XP_011809998.1.43180 XP_011810006.1.43180 XP_011810014.1.43180 XP_011810020.1.43180 XP_011810027.1.43180 XP_011810032.1.43180 XP_011810038.1.43180 XP_011830830.1.47321 XP_011830831.1.47321 XP_011830832.1.47321 XP_011830833.1.47321 XP_011830834.1.47321 XP_011830835.1.47321 XP_011830836.1.47321 XP_011830837.1.47321 XP_011830838.1.47321 XP_011830839.1.47321 XP_011913824.1.92194 XP_011913825.1.92194 XP_011913826.1.92194 XP_011913827.1.92194 XP_011913829.1.92194 XP_011913830.1.92194 XP_011913831.1.92194 XP_012006216.1.54773 XP_012030681.1.66739 XP_012303107.1.9421 XP_012303108.1.9421 XP_012303109.1.9421 XP_012303110.1.9421 XP_012303111.1.9421 XP_012357879.1.23891 XP_012406146.1.9362 XP_012518243.1.63892 XP_012518244.1.63892 XP_012518245.1.63892 XP_012518247.1.63892 XP_012518248.1.63892 XP_012518249.1.63892 XP_012518250.1.63892 XP_012518251.1.63892 XP_012518253.1.63892 XP_012588267.1.23501 XP_012631270.1.48125 XP_012631271.1.48125 XP_012631273.1.48125 XP_012631274.1.48125 XP_012631275.1.48125 XP_012631276.1.48125 XP_012631277.1.48125 XP_012631278.1.48125 XP_012665527.1.62490 XP_012665528.1.62490 XP_012665529.1.62490 XP_012665530.1.62490 XP_012880545.1.60039 XP_012913319.1.14098 XP_012952573.1.99704 XP_012952574.1.99704 XP_012952575.1.99704 XP_012952576.1.99704 XP_012952577.1.99704 XP_012970889.1.91757 XP_012970890.1.91757 XP_012970891.1.91757 XP_012984263.1.78019 XP_013028369.1.65836 XP_013028370.1.65836 XP_013028371.1.65836 XP_013028372.1.65836 XP_013028373.1.65836 XP_013151802.1.75256 XP_013366727.1.28644 XP_013366728.1.28644 XP_013802736.1.3284 XP_013964115.1.84170 XP_014136719.1.10750 XP_014307216.1.53796 XP_014380508.1.24877 XP_014380509.1.24877 XP_014421048.1.101512 XP_014421049.1.101512 XP_014421050.1.101512 XP_014421051.1.101512 XP_014421052.1.101512 XP_014464904.1.47583 XP_014464928.1.47583 XP_014646835.1.5094 XP_014721499.1.49734 XP_014721500.1.49734 XP_014721501.1.49734 XP_014721502.1.49734 XP_014725416.1.99236 XP_014725417.1.99236 XP_014793021.1.91963 XP_014793022.1.91963 XP_014793023.1.91963 XP_014793024.1.91963 XP_014793025.1.91963 XP_014793026.1.91963 XP_014917248.1.86478 XP_014917249.1.86478 XP_014917250.1.86478 XP_014917251.1.86478 XP_014917252.1.86478 XP_014950401.1.66739 XP_014964804.1.54773 XP_015006591.1.72884 XP_015006592.1.72884 XP_015006593.1.72884 XP_015006594.1.72884 XP_015091151.1.17985 XP_015091152.1.17985 XP_015147509.1.86415 XP_015147514.1.86415 XP_015208209.1.81211 XP_015208210.1.81211 XP_015208211.1.81211 XP_015208212.1.81211 XP_015208213.1.81211 XP_015208214.1.81211 XP_015285910.1.63531 XP_015285911.1.63531 XP_015285912.1.63531 XP_015285913.1.63531 XP_015285914.1.63531 XP_015353786.1.40921 XP_015393226.1.5354 XP_015484584.1.82291 XP_015484585.1.82291 XP_015484586.1.82291 XP_015675907.1.16292 XP_015723349.1.68032 XP_015723359.1.68032 XP_015723368.1.68032 XP_015723377.1.68032 XP_015850895.1.50099 XP_015850896.1.50099 XP_015850897.1.50099 XP_015850899.1.50099 XP_016015250.1.101085 XP_016015251.1.101085 XP_016015252.1.101085 XP_016015253.1.101085 XP_016015254.1.101085 XP_016045691.1.11023 XP_016045692.1.11023 XP_016052909.1.3490 XP_016052910.1.3490 XP_016281378.1.35504 XP_016778507.1.37143 XP_017176802.1.92730 XP_017384296.1.71028 XP_017384304.1.71028 XP_017384312.1.71028 XP_017384321.1.71028 XP_017384329.1.71028 XP_017384335.1.71028 XP_017384338.1.71028 XP_017384345.1.71028 XP_017448551.1.100692 XP_017448552.1.100692 XP_017448553.1.100692 XP_017448554.1.100692 XP_017448555.1.100692 XP_017515158.1.32401 XP_017515159.1.32401 XP_017515161.1.32401 XP_017515162.1.32401 XP_017515163.1.32401 XP_017515164.1.32401 XP_017679487.1.3805 XP_017679488.1.3805 XP_017679489.1.3805 XP_017679490.1.3805 XP_017679491.1.3805 XP_017679492.1.3805 XP_017679493.1.3805 XP_017679494.1.3805 XP_017729320.1.44346 XP_017729322.1.44346 XP_017729332.1.44346 XP_017729339.1.44346 XP_017729348.1.44346 XP_017831289.1.60252 XP_017831290.1.60252 XP_017903911.1.57651 XP_017903913.1.57651 XP_017936364.1.51550 XP_017936365.1.51550 XP_017936366.1.51550 XP_017936367.1.51550 XP_017936368.1.51550 XP_017936369.1.51550 XP_018611196.1.37976 XP_018611197.1.37976 XP_018775374.1.15306 XP_018894340.1.27298 XP_019307647.1.44245 XP_019307648.1.44245 XP_019307649.1.44245 XP_019307650.1.44245 XP_019307651.1.44245 XP_019307653.1.44245 XP_019345107.1.47583 XP_019345108.1.47583 XP_019345109.1.47583 XP_019371144.1.87953 XP_019371145.1.87953 XP_019371146.1.87953 XP_019371147.1.87953 XP_019371148.1.87953 XP_019371149.1.87953 XP_019371150.1.87953 XP_019400031.1.79039 XP_019400032.1.79039 XP_019400033.1.79039 XP_019400034.1.79039 XP_019400035.1.79039 XP_019400036.1.79039 XP_019400037.1.79039 XP_019498870.1.44202 XP_019498871.1.44202 XP_019498872.1.44202 XP_019498873.1.44202 XP_019498876.1.44202 XP_019498877.1.44202 XP_019498878.1.44202 XP_019498879.1.44202 XP_019498880.1.44202 XP_019600339.1.88060 XP_019600340.1.88060 XP_019600341.1.88060 XP_019600342.1.88060 XP_019654697.1.58354 XP_019654698.1.58354 XP_019654699.1.58354 XP_019654700.1.58354 XP_019654701.1.58354 XP_019690146.1.62641 XP_019690147.1.62641 XP_019690149.1.62641 XP_020664222.1.8467 XP_020664223.1.8467 XP_020664224.1.8467 XP_020735304.1.74333 XP_020735311.1.74333 XP_020735319.1.74333 XP_020735328.1.74333 XP_020735336.1.74333 XP_020735346.1.74333 XP_020850026.1.61212 XP_020850027.1.61212 XP_020946523.1.46622 XP_020946524.1.46622 XP_020946525.1.46622 XP_020946526.1.46622 XP_021046165.1.100879 XP_021046166.1.100879 XP_021390825.1.53032 XP_021390826.1.53032 XP_021390827.1.53032 XP_021509773.1.76796 XP_021509774.1.76796 XP_021509775.1.76796 XP_021509776.1.76796 XP_021546286.1.83697 XP_021586418.1.77405 ENSMLUP00000021836 ENSMMUP00000019684 ENSMMUP00000025374 ENSMMUP00000040148 ENSBTAP00000040639 ENSNLEP00000005212 ENSMUSP00000124862 ENSMUSP00000125335 ENSMUSP00000125589 10090.ENSMUSP00000069425 10116.ENSRNOP00000010623 9606.ENSP00000346689 9913.ENSBTAP00000040639 9986.ENSOCUP00000023573 ENSSTOP00000021041 ENSRNOP00000064297 ENSOCUP00000023573 ENSP00000312856 ENSP00000346689 ENSP00000412479 ENSP00000413703 ENSP00000439275 ENSP00000440099 ENSP00000444393 ENSP00000445751 ENSP00000446115 ENSSHAP00000009780 ENSMLUP00000021836 ENSOARP00000022107 ENSPTRP00000008089 gi|21361802|ref|NP_061110.2| gi|47778935|ref|NP_001001395.1| ENSBTAP00000040639 ENSRNOP00000010623 ENSCJAP00000021689 ENSCJAP00000040178 ENSCJAP00000040181 ENSSSCP00000000627 ENSPPYP00000004954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]