SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8WXC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8WXC6
Sequence length 57
Comment (sp|Q8WXC6|CSN9_HUMAN) Myeloma-overexpressed gene 2 protein {ECO:0000303|Ref.1} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MYEOV2 OC=Catarrhini; Hominidae; Homo.
Sequence
MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ
Download sequence
Identical sequences A0A091ID31 A0A091UQZ8 A0A093GUV7 A0A0E9Q1D0 A0A1U8D8K7 A0A218UW00 A0A2I0LW25 A0A2I3GG58 A0A2I3M4K2 A0A2J8IYG9 A0A2J8R801 A0A2K5DMV4 A0A2K5NAU7 A0A2K5PGC1 A0A2K5UB87 A0A2K5YWR5 A0A2K6DFS6 A0A2K6F0L5 A0A2K6L078 A0A2K6P9Q2 B5FZI1 F6U7P8 G1MY46 G3WYG9 H0XIK5 L8I9N4 Q32PD7 Q8WXC6 R4GFT1 W5MJJ0
ENSBTAP00000014490 ENSOGAP00000015945 ENSMMUP00000014875 ENSMGAP00000003841 ENSGALP00000033073 ENSP00000475979 ENSTGUP00000005622 ENSGALP00000040884 NP_001156896.1.87134 NP_001156896.1.92137 NP_001181980.1.59421 NP_001181980.1.76553 NP_001232296.1.42559 NP_001239297.1.84170 NP_001264634.1.86415 XP_001378012.4.35504 XP_001497389.3.31192 XP_002922523.1.58354 XP_003209093.1.16129 XP_003421217.1.64505 XP_003770226.1.9362 XP_003798293.1.62490 XP_004033495.2.27298 XP_004262585.1.21590 XP_004412746.1.74151 XP_004427796.1.5094 XP_004597471.1.84141 XP_004743801.1.14098 XP_005901540.1.15283 XP_006077231.1.26621 XP_006637748.1.81211 XP_006745072.1.47382 XP_007109176.1.24612 XP_007184904.1.59432 XP_008540869.1.77740 XP_008584908.1.73410 XP_010359118.1.97406 XP_010834238.1.44457 XP_010946414.1.22495 XP_010997481.1.51371 XP_011824930.1.47321 XP_012012605.1.54773 XP_012422198.1.74151 XP_012518845.1.63892 XP_012985725.1.78019 XP_013150559.1.75256 XP_013223301.1.63277 XP_014113834.1.90289 XP_014137416.1.10750 XP_014377613.1.24877 XP_014458286.1.47583 XP_014698338.1.49734 XP_014725778.1.99236 XP_014821786.1.91963 XP_015492490.1.82291 XP_015726739.1.68032 XP_017376780.1.71028 XP_017690594.1.3805 XP_017938644.1.51550 XP_019145012.1.2935 XP_019300885.1.44245 XP_019300886.1.44245 XP_019359231.1.87953 XP_019398492.1.79039 XP_019483468.1.44202 XP_019567275.1.88060 XP_020768876.1.74333 XP_020861482.1.61212 XP_021251616.1.32913 XP_021411448.1.53032 XP_021534660.1.83697 ENSSHAP00000020474 gi|254540132|ref|NP_001156896.1| ENSSHAP00000020474 ENSLOCP00000008549 ENSOGAP00000015945 ENSMGAP00000003841 ENSP00000475979 ENSMMUP00000014875 ENSBTAP00000014490 ENSTGUP00000005622 13616.ENSMODP00000016892 59729.ENSTGUP00000005622 9031.ENSGALP00000033073 9544.ENSMMUP00000014875 9913.ENSBTAP00000014490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]