SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8WXH6 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8WXH6
Domain Number 1 Region: 10-183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.31e-44
Family G proteins 0.0000244
Further Details:      
 
Domain Number 2 Region: 189-227
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000968
Family SOCS box-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 40.37
actin cytoskeleton 1.374 29.03
cilium 1.675 22.42
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
ciliary part 1.819 21.32
chromosomal part 1.512 20.08
midbody 2.182 17.6
side of membrane 1.633 16
nucleoplasm part 1.369 15.74

Protein sequence

External link(s) Q8WXH6
Sequence length 277
Comment (sp|Q8WXH6|RB40A_HUMAN) SOCS box-containing protein RAR2A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RAB40A; OC=Catarrhini; Hominidae; Homo.
Sequence
MSAPGSPDQAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDG
QRVKLKLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPGVP
KILVGNRLHLAFKRQVPREQAQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRM
NWLGRPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNARMMRGLS
YSLTTSSTHKSSLCKVEIVCPPQSPPKNCTRNSCKIS
Download sequence
Identical sequences Q8WXH6
ENSP00000305648 ENSP00000305648 ENSP00000361716 gi|56550077|ref|NP_543155.2| 9606.ENSP00000305648 ENSP00000305648 ENSP00000361716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]