SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8WXH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8WXH6
Domain Number 1 Region: 10-183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.31e-44
Family G proteins 0.0000244
Further Details:      
 
Domain Number 2 Region: 189-227
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000968
Family SOCS box-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8WXH6
Sequence length 277
Comment (sp|Q8WXH6|RB40A_HUMAN) SOCS box-containing protein RAR2A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RAB40A; OC=Catarrhini; Hominidae; Homo.
Sequence
MSAPGSPDQAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDG
QRVKLKLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPGVP
KILVGNRLHLAFKRQVPREQAQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRM
NWLGRPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNARMMRGLS
YSLTTSSTHKSSLCKVEIVCPPQSPPKNCTRNSCKIS
Download sequence
Identical sequences Q8WXH6
ENSP00000305648 9606.ENSP00000305648 gi|56550077|ref|NP_543155.2| ENSP00000305648 ENSP00000361716 NP_543155.2.87134 NP_543155.2.92137 XP_005262140.1.92137 XP_011529174.1.92137 ENSP00000305648 ENSP00000361716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]