SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8WY91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8WY91
Domain Number 1 Region: 416-575
Classification Level Classification E-value
Superfamily Lipocalins 5.87e-47
Family Rv2717c-like 0.0000685
Further Details:      
 
Domain Number 2 Region: 1-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.98e-21
Family THAP domain 0.00034
Further Details:      
 
Weak hits

Sequence:  Q8WY91
Domain Number - Region: 295-390
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0523
Family MED7 hinge region 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8WY91
Sequence length 577
Comment (sp|Q8WY91|THAP4_HUMAN) THAP domain-containing protein 4 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=THAP4; OC=Catarrhini; Hominidae; Homo.
Sequence
MVICCAAVNCSNRQGKGEKRAVSFHRFPLKDSKRLIQWLKAVQRDNWTPTKYSFLCSEHF
TKDSFSKRLEDQHRLLKPTAVPSIFHLTEKKRGAGGHGRTRRKDASKATGGVRGHSSAAT
SRGAAGWSPSSSGNPMAKPESRRLKQAALQGEATPRAAQEAASQEQAQQALERTPGDGLA
TMVAGSQGKAEASATDAGDESATSSIEGGVTDKSGISMDDFTPPGSGACKFIGSLHSYSF
SSKHTRERPSVPREPIDRKRLKKDVEPSCSGSSLGPDKGLAQSPPSSSLTATPQKPSQSP
SAPPADVTPKPATEAVQSEHSDASPMSINEVILSASGACKLIDSLHSYCFSSRQNKSQVC
CLREQVEKKNGELKSLRQRVSRSDSQVRKLQEKLDELRRVSVPYPSSLLSPSREPPKMNP
VVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMH
RECGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHSIARISFAKEPHVEQIT
RKFRLNSEGKLEQTVSMATTTQPMTQHLHVTYKKVTP
Download sequence
Identical sequences Q8WY91
ENSP00000385006 gi|256818825|ref|NP_057047.4| 9606.ENSP00000385006 ENSP00000385006 ENSP00000384352 NP_057047.4.87134 NP_057047.4.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]