SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q92485 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92485
Domain Number 1 Region: 22-348
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.48e-55
Family ADPRibase-Mn-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q92485
Sequence length 455
Comment (sp|Q92485|ASM3B_HUMAN) Acid sphingomyelinase-like phosphodiesterase 3b KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SMPDL3B; OC=Catarrhini; Hominidae; Homo.
Sequence
MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGSQPVPDAGPWG
DYLCDSPWALINSSIYAMKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIR
EVFPDTKVYAALGNHDFHPKNQFPAGSNNIYNQIAELWKPWLSNESIALFKKGAFYCEKL
PGPSGAGRIVVLNTNLYYTSNALTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPG
FFEKTQNKAWFREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYDDAGVPISAMFIT
PGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKDMVTYFMNLSQANAQGTPRWELEYQ
LTEAYGVPDASAHSMHTVLDRIAGDQSTLQRYYVYNSVSYSAGVCDEACSMQHVCAMRQV
DIDAYTTCLYASGTTPVPQLPLLLMALLGLCTLVL
Download sequence
Identical sequences Q92485
ENSP00000362995 ENSP00000363001 gi|57242798|ref|NP_055289.2| HR5168 NYSGXRC-8719a ENSP00000363001 9606.ENSP00000363001 NP_055289.2.87134 NP_055289.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]