SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q92503 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92503
Domain Number 1 Region: 320-503
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 5.1e-47
Family CRAL/TRIO domain 0.0000302
Further Details:      
 
Domain Number 2 Region: 231-317
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 6.15e-23
Family CRAL/TRIO N-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 523-688
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.22e-20
Family Supernatant protein factor (SPF), C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q92503
Sequence length 715
Comment (sp|Q92503|S14L1_HUMAN) SEC14-like protein 1 {ECO:0000305} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SEC14L1; OC=Catarrhini; Hominidae; Homo.
Sequence
MVQKYQSPVRVYKYPFELIMAAYERRFPTCPLIPMFVGSDTVNEFKSEDGAIHVIERRCK
LDVDAPRLLKKIAGVDYVYFVQKNSLNSRERTLHIEAYNETFSNRVIINEHCCYTVHPEN
EDWTCFEQSASLDIKSFFGFESTVEKIAMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPR
WSPPSITTSSETSSSSSKKQAASMAVVIPEAALKEGLSGDALSSPSAPEPVVGTPDDKLD
ADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHILRFLRARDFNIDKAREIMCQ
SLTWRKQHQVDYILETWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGE
EALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEV
VEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDK
EIIPDFLSGECMCEVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILI
QIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQ
LGRDYSMVESPLICKEGESVQGSHVTRWPGFYILQWKFHSMPACAASSLPRVDDVLASLQ
VSSHKCKVMYYTEVIGSEDFRGSMTSLESSHSGFSQLSAATTSSSQSHSSSMISR
Download sequence
Identical sequences Q92503
ENSP00000390392 ENSP00000394716 ENSP00000408169 ENSP00000466581 ENSP00000390392 ENSP00000408169 ENSP00000466581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]