SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q92597 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92597
Domain Number 1 Region: 30-310
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.38e-28
Family Biotin biosynthesis protein BioH 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q92597
Sequence length 394
Comment (sp|Q92597|NDRG1_HUMAN) Rit42 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NDRG1; OC=Catarrhini; Hominidae; Homo.
Sequence
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVIL
TYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAE
MLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKI
SGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIE
RPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAK
LAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGT
RSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
Download sequence
Identical sequences Q92597
ENSP00000319977 ENSP00000404854 400327 ENSP00000319977 9606.ENSP00000319977 gi|207028748|ref|NP_001128714.1| gi|37655183|ref|NP_006087.2| ENSP00000319977 ENSP00000404854 NP_001128714.1.87134 NP_001128714.1.92137 NP_006087.2.87134 NP_006087.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]