SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q92610 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92610
Domain Number 1 Region: 983-1033
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000192
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  Q92610
Domain Number - Region: 862-912
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.001
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 799-845
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00174
Family Classic zinc finger, C2H2 0.052
Further Details:      
 
Domain Number - Region: 741-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00216
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 582-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0071
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number - Region: 708-726,788-804
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0107
Family Cytochrome c3-like 0.045
Further Details:      
 
Domain Number - Region: 1123-1173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0385
Family C2HC finger 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q92610
Sequence length 1267
Comment (sp|Q92610|ZN592_HUMAN) Zinc finger protein 592 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF592; OC=Catarrhini; Hominidae; Homo.
Sequence
MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSA
PDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSA
RSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGCGAVGG
PVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGE
ALEFNSHPSNSIGESKGLARELGTCSSVPPRQRLKPAHSKLSSCVAALVALQAKRVASVT
KEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSICSDSSSKG
SPSVAASSPPAIPKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPVGSPLGSAIAEAPSE
MPGDEVPVEEHFPEAGTNSGSPQGARKGDESMTKASDSSSPSCSSGPRVPKGAAPGSQTG
KKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQLTQMSVPL
VHQVKKAAPLIVEVFNKVLHSSNPVPLYAPNLSPPADSRIHVPASGYCCLECGDAFALEK
SLSQHYGRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLLVKPISADQ
MFVSAPVNSTAPAAPAPSSSPKHGLTSGSASPPPPALPLYPDPVRLIRYSIKCLECHKQM
RDYMVLAAHFQRTTEETEGLTCQVCQMLLPNQCSFCAHQRIHAHKSPYCCPECGVLCRSA
YFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFCPMAFKTAS
STADHSATQHPTQPHRPSQLIYKCSCEMVFNKKRHIQQHFYQNVSKTQVGVFKCPECPLL
FVQKPELMQHVKSTHGVPRNVDELSSLQSSADTSSSRPGSRVPTEPPATSVAARSSSLPS
GRWGRPEAHRRVEARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKRYPCRQCEQ
SFHTPNSLRKHIRNNHDTVKKFYTCGYCTEDSPSFPRPSLLESHISLMHGIRNPDLSQTS
KVKPPGGHSPQVNHLKRPVSGVGDAPGTSNGATVSSTKRHKSLFQCAKCSFATDSGLEFQ
SHIPQHQVDSSTAQCLLCGLCYTSASSLSRHLFIVHKVRDQEEEEEEEAAAAEMAVEVAE
PEEGSGEEVPMETRENGLEECAGEPLSADPEARRLLGPAPEDDGGHNDHSQPQASQDQDS
HTLSPQV
Download sequence
Identical sequences Q92610
ENSP00000299927 9606.ENSP00000299927 ENSP00000299927 ENSP00000452877 gi|108860697|ref|NP_055445.2| ENSP00000299927 ENSP00000452877 NP_055445.2.87134 NP_055445.2.92137 XP_005255053.1.92137 XP_011520548.1.92137 XP_011520549.1.92137 XP_016878223.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]