SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q92613 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92613
Domain Number 1 Region: 192-263
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.99e-18
Family PHD domain 0.0074
Further Details:      
 
Weak hits

Sequence:  Q92613
Domain Number - Region: 304-341
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0102
Family PHD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q92613
Sequence length 823
Comment (sp|Q92613|JADE3_HUMAN) PHD finger protein 16 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=JADE3; OC=Catarrhini; Hominidae; Homo.
Sequence
MKRHRPVSSSDSSDESPSTSFTSGSMYRIKSKIPNEHKKPAEVFRKDLISAMKLPDSHHI
NPDSYYLFADTWKEEWEKGVQVPASPDTVPQPSLRIIAEKVKDVLFIRPRKYIHCSSPDT
TEPGYINIMELAASVCRYDLDDMDIFWLQELNEDLAEMGCGPVDENLMEKTVEVLERHCH
ENMNHAIETEEGLGIEYDEDVICDVCRSPDSEEGNDMVFCDKCNVCVHQACYGILKVPEG
SWLCRSCVLGIYPQCVLCPKKGGALKTTKTGTKWAHVSCALWIPEVSIACPERMEPITKI
SHIPPSRWALVCNLCKLKTGACIQCSIKSCITAFHVTCAFEHGLEMKTILDEGDEVKFKS
YCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFYSLVRVEDVAAEL
GMPTLAVDFIYNYWKLKRKSNFNKPLFPPKEDEENGLVQPKEESIHTRMRMFMHLRQDLE
RVRNLCYMISRREKLKLSHNKIQEQIFGLQVQLLNQEIDAGLPLTNALENSLFYPPPRIT
LKLKMPKSTPEDHRNSSTETDQQPHSPDSSSSVHSIRNMQVPQESLEMRTKSYPRYPLES
KNNRLLASLSHSRSEAKESSPAWRTPSSECYHGQSLGKPLVLQAALHGQSSIGNGKSQPN
SKFAKSNGLEGSWSGNVTQKDSSSEMFCDQEPVFSPHLVSQGSFRKSTVEHFSRSFKETT
NRWVKNTEDLQCYVKPTKNMSPKEQFWGRQVLRRSAGRAPYQENDGYCPDLELSDSEAES
DGNKEKVRVRKDSSDRENPPHDSRRDCHGKSKTHPLSHSSMQR
Download sequence
Identical sequences A0A024R1A2 Q92613
ENSP00000479377 ENSP00000481850 gi|117190334|ref|NP_001070913.1| gi|7662006|ref|NP_055550.1| 9606.ENSP00000218343 NP_001070913.1.87134 NP_001070913.1.92137 NP_055550.1.87134 NP_055550.1.92137 ENSP00000218343 ENSP00000380373 ENSP00000474355 ENSP00000380373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]