SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q92692 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92692
Domain Number 1 Region: 37-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000744
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 
Domain Number 2 Region: 257-350
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000159
Family I set domains 0.036
Further Details:      
 
Domain Number 3 Region: 159-254
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000473
Family C1 set domains (antibody constant domain-like) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q92692
Sequence length 538
Comment (sp|Q92692|NECT2_HUMAN) Poliovirus receptor-related protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NECTIN2 OC=Catarrhini; Hominidae; Homo.
Sequence
MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPV
PGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAEL
QDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTV
ALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKV
EHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTS
GTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
IIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM
PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPV
PPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV
Download sequence
Identical sequences Q92692
gi|112789532|ref|NP_001036189.1| ENSP00000252483 NP_001036189.1.87134 NP_001036189.1.92137 9606.ENSP00000252483 ENSP00000252483 NYSGRC-IgSF-PVRL2_HUMAN ENSP00000252483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]