SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q92738 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92738
Domain Number 1 Region: 73-252
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.42e-49
Family Ypt/Rab-GAP domain of gyp1p 0.0037
Further Details:      
 
Domain Number 2 Region: 227-339
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.71e-28
Family Ypt/Rab-GAP domain of gyp1p 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q92738
Sequence length 828
Comment (sp|Q92738|US6NL_HUMAN) Related to the N-terminus of tre KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=USP6NL; OC=Catarrhini; Hominidae; Homo.
Sequence
MNSDQDVALKLAQERAEIVAKYDRGREGAEIEPWEDADYLVYKVTDRFGFLHEEELPDHN
VAVERQKHLEIERTTKWLKMLKGWEKYKNTEKFHRRIYKGIPLQLRGEVWALLLEIPKMK
EETRDLYSKLKHRARGCSPDIRQIDLDVNRTFRDHIMFRDRYGVKQQSLFHVLAAYSIYN
TEVGYCQGMSQITALLLMYMNEEDAFWALVKLFSGPKHAMHGFFVQGFPKLLRFQEHHEK
ILNKFLSKLKQHLDSQEIYTSFYTMKWFFQCFLDRTPFTLNLRIWDIYIFEGERVLTAMS
YTILKLHKKHLMKLSMEELVEFFQETLAKDFFFEDDFVIEQLQISMTELKRAKLDLPEPG
KEDEYPKKPLGQLPPELQSWGVHHLSNGQRSVGRPSPLASGRRESGAPHRRHEHSPHPQS
RTGTPERAQPPRRKSVEEESKKLKDEADFQRKLPSGPQDSSRQYNHAAANQNSNATSNIR
KEFVPKWNKPSDVSATERTAKYTMEGKGRAAHPALAVTVPGPAEVRVSNVRPKMKALDAE
DGKRGSTASQYDNVPGPELDSGASVEEALERAYSQSPRHALYPPSPRKHAEPSSSPSKVS
NKFTFKVQPPSHARYPSQLDGEARGLAHPPSYSNPPVYHGNSPKHFPTANSSFASPQFSP
GTQLNPSRRPHGSTLSVSASPEKSYSRPSPLVLPSSRIEVLPVDTGAGGYSGNSGSPKNG
KLIIPPVDYLPDNRTWSEVSYTYRPETQGQSWTRDASRGNLPKYSAFQLAPFQDHGLPAV
SVDSPVRYKASPAAEDASPSGYPYSGPPPPAYHYRNRDGLSIQESVLL
Download sequence
Identical sequences Q92738
ENSP00000476462 HR4397 NP_055503.1.87134 NP_055503.1.92137 gi|7661864|ref|NP_055503.1| ENSP00000476462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]