SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q92832 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92832
Domain Number 1 Region: 30-213
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.36e-37
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 267-333
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000022
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 476-584
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000111
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 4 Region: 682-754
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000513
Family VWC domain 0.022
Further Details:      
 
Domain Number 5 Region: 427-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000254
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 589-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 334-391
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000628
Family VWC domain 0.034
Further Details:      
 
Weak hits

Sequence:  Q92832
Domain Number - Region: 392-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00474
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 765-802
Classification Level Classification E-value
Superfamily FnI-like domain 0.0837
Family VWC domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
collagen trimer 2.224 27.17
microfibril 1.548 19.82
nucleoplasm part 1.369 15.88
integral component of plasma membrane 1.428 14.25
presynapse 1.758 14.25
nuclear outer membrane-endoplasmic reticulum membrane network 1.527 13.72
nuclear envelope 1.891 13.59
cilium 1.675 11.86
ciliary part 1.819 11.86
plasma membrane receptor complex 1.824 11.77

Protein sequence

External link(s) Q92832
Sequence length 810
Comment (sp|Q92832|NELL1_HUMAN) Nel-related protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NELL1; OC=Catarrhini; Hominidae; Homo.
Sequence
MPMDLILVVWFCVCTARTVVGFGMDPDLQMDIVTELDLVNTTLGVAQVSGMHNASKAFLF
QDIEREIHAAPHVSEKLIQLFRNKSEFTILATVQQKPSTSGVILSIRELEHSYFELESSG
LRDEIRYHYIHNGKPRTEALPYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPDT
NLPPGINLWLGQRNQKHGLFKGIIQDGKIIFMPNGYITQCPNLNHTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSG
AVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGV
LVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECKNWNTKATCECKS
GYISVQGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDEC
GSGQHNCDENAICTNTVQGHSCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNKCVCPSG
FTGSHCEKDIDECSEGIIECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDEC
ALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWTLKEDRCSVCSCK
DGKIFCRRTACDCQNPSADLFCCPECDTRVTSQCLDQNGHKLYRSGDNWTHSCQQCRCLE
GEVDCWPLTCPNLSCEYTAILEGECCPRCVSDPCLADNITYDIRKTCLDSYGVSRLSGSV
WTMAGSPCTTCKCKNGRVCCSVDFECLQNN
Download sequence
Identical sequences Q92832
9606.ENSP00000298925 ENSP00000349654 gi|222352164|ref|NP_006148.2| ENSP00000349654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]