SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q92871 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92871
Domain Number 1 Region: 15-240
Classification Level Classification E-value
Superfamily HAD-like 6.27e-72
Family Predicted hydrolases Cof 0.00000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q92871
Sequence length 262
Comment (sp|Q92871|PMM1_HUMAN) PMMH-22 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PMM1; OC=Catarrhini; Hominidae; Homo.
Sequence
MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIA
EQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLR
LPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLR
FSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSV
VSPQDTVQRCREIFFPETAHEA
Download sequence
Identical sequences A0A024R1U5 A0A2I3H620 G3RT06 H2QLS6 Q92871
gi|194097356|ref|NP_002667.2| ENSPTRP00000024860 ENSP00000216259 2fueA NP_002667.2.87134 NP_002667.2.92137 XP_003264853.1.23891 XP_003814680.1.60992 XP_004063612.2.27298 XP_515159.2.37143 ENSPTRP00000024860 ENSP00000216259 ENSP00000216259 9598.ENSPTRP00000024860 9606.ENSP00000216259 ENSNLEP00000018904 ENSNLEP00000018904 2fuc_A 2fue_A 6cfv_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]