SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q92963 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92963
Domain Number 1 Region: 20-205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.56e-51
Family G proteins 0.00000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q92963
Sequence length 219
Comment (sp|Q92963|RIT1_HUMAN) Ras-like without CAAX protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RIT1; OC=Catarrhini; Hominidae; Homo.
Sequence
MDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKI
RIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYR
VRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVR
EIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT
Download sequence
Identical sequences A0A2I3G667 A0A2J8K4Z0 A0A2K5J156 A0A2K5YAS3 A0A2K6Q684 H2N5F8 H9FY34 Q92963
NP_001248730.1.72884 NP_008843.1.87134 NP_008843.1.92137 XP_003259486.1.23891 XP_005541557.1.63531 XP_007974997.1.81039 XP_008972837.1.60992 XP_008972838.1.60992 XP_008972839.1.60992 XP_009241451.1.23681 XP_009241456.1.23681 XP_009241460.1.23681 XP_009241463.1.23681 XP_009432240.1.37143 XP_009432248.1.37143 XP_009432256.1.37143 XP_009432266.1.37143 XP_010366406.1.97406 XP_011783754.1.43180 XP_011848103.1.47321 XP_011934012.1.92194 XP_012366948.1.23891 XP_012366949.1.23891 XP_018879602.1.27298 ENSP00000357306 ENSMMUP00000024831 ENSPPYP00000000854 gi|5902050|ref|NP_008843.1| ENSPANP00000010886 ENSP00000357306 ENSMMUP00000024831 ENSPPYP00000000854 ENSNLEP00000014860 9544.ENSMMUP00000024831 9606.ENSP00000357306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]