SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q969M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q969M3
Sequence length 257
Comment (sp|Q969M3|YIPF5_HUMAN) YPT-interacting protein 1 A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PP12723, OC=Catarrhini; Hominidae; Homo.
Sequence
MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQ
PYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGS
IMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV
ASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLV
AYPCALLYGVFALISVF
Download sequence
Identical sequences A0A2J8VNU0 A0A2K6JVD3 A0A2K6NKU6 G3RZC7 H2QRP8 Q5R6W5 Q969M3
gi|32401427|ref|NP_110426.4| gi|68226422|ref|NP_001020118.1| ENSP00000274496 ENSP00000397704 ENSPTRP00000029682 9606.ENSP00000274496 ENSP00000274496 ENSP00000397704 ENSPTRP00000029682 NP_001020118.1.87134 NP_001020118.1.92137 NP_001127558.1.23681 NP_110426.4.87134 NP_110426.4.92137 XP_003829142.1.60992 XP_004042797.2.27298 XP_010386586.1.97406 XP_010386587.1.97406 XP_017740024.1.44346 XP_518011.2.37143 ENSPPYP00000017789 ENSPPYP00000017789 ENSP00000274496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]