SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q969M3 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q969M3
Sequence length 257
Comment (sp|Q969M3|YIPF5_HUMAN) YPT-interacting protein 1 A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PP12723, OC=Catarrhini; Hominidae; Homo.
Sequence
MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQ
PYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGS
IMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV
ASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLV
AYPCALLYGVFALISVF
Download sequence
Identical sequences H2QRP8 Q5R6W5 Q969M3
ENSPPYP00000017789 ENSPTRP00000029682 ENSP00000274496 9606.ENSP00000274496 ENSPPYP00000017789 ENSP00000274496 ENSP00000397704 gi|32401427|ref|NP_110426.4| gi|68226422|ref|NP_001020118.1| ENSPTRP00000029682 ENSP00000274496 ENSP00000397704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]