SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96AC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96AC6
Domain Number 1 Region: 402-708
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.72e-89
Family Motor proteins 0.00000603
Further Details:      
 
Weak hits

Sequence:  Q96AC6
Domain Number - Region: 276-349
Classification Level Classification E-value
Superfamily Tropomyosin 0.0255
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q96AC6
Sequence length 838
Comment (sp|Q96AC6|KIFC2_HUMAN) Kinesin-like protein KIFC2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KIFC2; OC=Catarrhini; Hominidae; Homo.
Sequence
MYAFYSLLIYIFYSLFRRDGGAAAAAEPGDPAQRARKPRGRRRPDLPAPELWTELTGLAA
SSEPEDGSEGAAEGRAAAVSLEEALLRLAEFLSVQLGAEESCGGPADLGQSGEVPSLLTV
TSQLLALLAWLRSPRGRQALLQGTQPAPRVRPPSPDGSTSQEESPSHFTAVPGEPLGDET
QGQQPLQLEEDQRAWQRLEQLILGQLEELKQQLEQQEEELGRLRLGVGATDSEKRVQHLT
LENEALKQSLSLMRDLLLHWGPGPPIRAPQEEAEALLELQGRLQEAQDTTEALRAQLGVQ
EVQLQGLQGALQQLQQETEQNCRRELQQMHGQLAGLRARMASLRQGCGDLRGLVSTFTQS
CQGSLSEARGQVSWALGALSSGGPGTQLPEGQQGPPAGCPGRLPELKGNIRVLCRLRPGT
SSSLVSVEPGPGGTVTTCYRGRHRRFRLDWVFPPDASQEEVFRELEPAVLSCLRGYSVCI
FTYGQTGTGKTYSMEGPPEDPGIVPRALQSLFREMGAGRQHRVTLSMVEIYNEAVRDLLA
PGPPERLAVRQGPEGQGGIQVAGLTHWDVPNLETLHQMLKLGRSNRATAATAMNQRSSRS
HALVTLTLRAASPPRAPGTAGTLHLVDLAGSERARKAGAAGPPRGDPDGARRLREAQTIN
RSLLALGGVMAALRAHRPHVPFRDSQLTRLLQPALGPGTTAVLLLQVGAGAGQVCACRSP
PTRARPPAPLARRSPRGRRISGRQSAPSSSPTEWVKWSWGQPGAAGSRAPPGRLLPSAPT
LRSPGPPAPLRRPLAVLHAPVPTTARARLSRPQRACPSSPGSRPCPWGLRPGLCWQRR
Download sequence
Identical sequences Q96AC6
NP_665697.1.87134 NP_665697.1.92137 gi|21955174|ref|NP_665697.1| ENSP00000301331 ENSP00000301332 9606.ENSP00000301332 ENSP00000301332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]