SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96B01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q96B01
Sequence length 352
Comment (sp|Q96B01|R51A1_HUMAN) RAD51-interacting protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RAD51AP1 OC=Catarrhini; Hominidae; Homo.
Sequence
MVRPVRHKKPVNYSQFDHSDSDDDFVSATVPLNKKSRTAPKELKQDKPKPNLNNLRKEEI
PVQEKTPKKRLPEGTFSIPASAVPCTKMALDDKLYQRDLEVALALSVKELPTVTTNVQNS
QDKSIEKHGSSKIETMNKSPHISNCSVASDYLDLDKITVEDDVGGVQGKRKAASKAAAQQ
RKILLEGSDGDSANDTEPDFAPGEDSEDDSDFCESEDNDEDFSMRKSKVKEIKKKEVKVK
SPVEKKEKKSKSKCNALVTSVDSAPAAVKSESQSLPKKVSLSSDTTRKPLEIRSPSAESK
KPKWVPPAASGGSRSSSSPLVVVSVKSPNQSLRLGLSRLARVKPLHPNATST
Download sequence
Identical sequences Q96B01
gi|195947391|ref|NP_001124334.1| ENSP00000323750 ENSP00000228843 ENSP00000228843 NP_001124334.1.87134 NP_001124334.1.92137 9606.ENSP00000228843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]