SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96BI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96BI1
Domain Number 1 Region: 25-420
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.15e-45
Family LacY-like proton/sugar symporter 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q96BI1
Sequence length 424
Comment (sp|Q96BI1|S22AI_HUMAN) p45-Beckwith-Wiedemann region 1 A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=BWR1A, OC=Catarrhini; Hominidae; Homo.
Sequence
MQGARAPRDQGRSPGRMSALGRSSVILLTYVLAATELTCLFMQFSIVPYLSRKLGLDSIA
FGYLQTTFGVLQLLGGPVFGRFADQRGARAALTLSFLAALALYLLLAAASSPALPGVYLL
FASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLGLCFGVGVILGSLLGGTLVSAYGI
QCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDV
PRIFLVKVASNCPTGLFMVMFSIISMDFFQLEAAQAGYLMSFFGLLQMVTQGLVIGQLSS
HFSEEVLLRASVLVFIVVGLAMAWMSSVFHFCLLVPGLVFSLCTLNVVTDSMLIKAVSTS
DTGTMLGLCASVQPLLRTLGPTVGGLLYRSFGVPVFGHVQVAINTLVLLVLWRKPMPQRK
DKVR
Download sequence
Identical sequences Q96BI1
ENSP00000307859 ENSP00000311139 ENSP00000369948 ENSP00000307859 ENSP00000311139 ENSP00000369948 NP_002546.3.87134 NP_002546.3.92137 NP_899056.2.87134 NP_899056.2.92137 gi|166064060|ref|NP_899056.2| gi|166064062|ref|NP_002546.3| 9606.ENSP00000307859 ENSP00000307859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]