SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96C10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96C10
Domain Number 1 Region: 47-170,350-494
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.25e-44
Family Tandem AAA-ATPase domain 0.0017
Further Details:      
 
Weak hits

Sequence:  Q96C10
Domain Number - Region: 1-73,161-296
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0031
Family Tandem AAA-ATPase domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q96C10
Sequence length 678
Comment (sp|Q96C10|DHX58_HUMAN) RIG-I-like receptor LGP2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=DHX58; OC=Catarrhini; Hominidae; Homo.
Sequence
MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLV
TQHGEEFRRMLDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHV
ELTVFSLIVVDECHHTHKDTVYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDG
AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQI
HDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVYALHLRRYNDALLIHDTVRAV
DALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPKLEMLEKILQR
QFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQ
QEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYA
FVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQR
ENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKV
FKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVP
DFDFLQHCAENLSDLSLD
Download sequence
Identical sequences A0A024R1Y5 Q96C10
9606.ENSP00000251642 gi|149408122|ref|NP_077024.2| ENSP00000251642 ENSP00000251642 ENSP00000455290 NP_077024.2.87134 NP_077024.2.92137 XP_016880548.1.92137 XP_016880549.1.92137 ENSP00000251642 ENSP00000455290 NYSGRC-149408122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]