SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96CB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96CB8
Domain Number 1 Region: 147-225
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.15e-17
Family PHD domain 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q96CB8
Sequence length 462
Comment (sp|Q96CB8|INT12_HUMAN) PHD finger protein 22 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=INTS12; OC=Catarrhini; Hominidae; Homo.
Sequence
MAATVNLELDPIFLKALGFLHSKSKDSAEKLKALLDESLARGIDSSYRPSQKDVEPPKIS
STKNISIKQEPKISSSLPSGNNNGKVLTTEKVKKEAEKRPADKMKSDITEGVDIPKKPRL
EKPETQSSPITVQSSKDLPMADLSSFEETSADDFAMEMGLACVVCRQMMVASGNQLVECQ
ECHNLYHRDCHKPQVTDKEANDPRLVWYCARCTRQMKRMAQKTQKPPQKPAPAVVSVTPA
VKDPLVKKPETKLKQETTFLAFKRTEVKTSTVISGNSSSASVSSSVTSGLTGWAAFAAKT
SSAGPSTAKLSSTTQNNTGKPATSSANQKPVGLTGLATSSKGGIGSKIGSNNSTTPTVPL
KPPPPLTLGKTGLSRSVSCDNVSKVGLPSPSSLVPGSSSQLSGNGNSGTSGPSGSTTSKT
TSESSSSPSASLKGPTSQESQLNAMKRLQMVKKKAAQKKLKK
Download sequence
Identical sequences A0A024RDK4 Q96CB8
NP_001135943.1.87134 NP_001135943.1.92137 NP_065128.2.87134 NP_065128.2.92137 XP_005263205.1.92137 XP_011530445.1.92137 XP_011530447.1.92137 9606.ENSP00000265150 gi|21361851|ref|NP_065128.2| gi|215599585|ref|NP_001135943.1| ENSP00000340737 ENSP00000378221 ENSP00000415433 ENSP00000340737 ENSP00000378221 ENSP00000415433 ENSP00000340737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]