SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96EG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96EG1
Domain Number 1 Region: 33-522
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.49e-113
Family Arylsulfatase 0.000000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q96EG1
Sequence length 525
Comment (sp|Q96EG1|ARSG_HUMAN) Arylsulfatase G KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARSG; OC=Catarrhini; Hominidae; Homo.
Sequence
MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKD
TANLDKMASEGMRFVDFHAAASTCSPSRASLLTGRLGLRNGVTRNFAVTSVGGLPLNETT
LAEVLQQAGYVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPA
CPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRP
FLLYVALAHMHVPLPVTQLPAAPRGRSLYGAGLWEMDSLVGQIKDKVDHTVKENTFLWFT
GDNGPWAQKCELAGSVGPFTGFWQTRQGGSPAKQTTWEGGHRVPALAYWPGRVPVNVTST
ALLSVLDIFPTVVALAQASLPQGRRFDGVDVSEVLFGRSQPGHRVLFHPNSGAAGEFGAL
QTVRLERYKAFYITGGARACDGSTGPELQHKFPLIFNLEDDTAEAVPLERGGAEYQAVLP
EVRKVLADVLQDIANDNISSADYTQDPSVTPCCNPYQIACRCQAA
Download sequence
Identical sequences A0A024R8K1 Q96EG1
gi|45430057|ref|NP_055775.2| 9606.ENSP00000347310 ENSP00000407193 ENSP00000459720 ENSP00000407193 ENSP00000480910 ENSP00000407193 ENSP00000459720 NP_001254656.1.87134 NP_001254656.1.92137 NP_055775.2.87134 NP_055775.2.92137 XP_005257227.1.92137 XP_016879850.1.92137 XP_016879851.1.92137 XP_016879852.1.92137 XP_016879853.1.92137 XP_016879854.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]