SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96EK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96EK2
Domain Number 1 Region: 349-405
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000842
Family PHD domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q96EK2
Sequence length 531
Comment (sp|Q96EK2|PF21B_HUMAN) PHD finger protein 21B KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PHF21B; OC=Catarrhini; Hominidae; Homo.
Sequence
MELQSRPEALAVELARHQNGDLKKQLHERQPRIAALSDKQALGTITAVPVTGPQVSSLQR
LAGQGAAVLPQVRPKTLIPDSLPVAPGRDRPPKQPPTFQKATVVSVKNPSPALPTANNTV
SHVPAPGSQPQALAEPAALASPLSSAGVAYAIISTSPSNAAAMAPSTAVSVVSDSIKVQP
LLISADNKPPPRLLSSPHPATHHCPLHPSSLPLTPPSPSLSPSPLHGIFQVIIIQPQVQT
QPESTAESRPPTEEPSQGAQATKKKKEDRPPTQENPEKIAFMVALGLVTTEHLEEIQSKR
QERKRRSTANPAYSGLLETERKRLASNYLNNPLFLTARANEDPCWKNEITHDEHCAACKR
GANLQPCGTCPGAYHLSCLEPPLKTAPKGVWVCPRCQQKALKKDEGVPWTGMLAIVHSYV
THKTVKEEEKQKLLQRGSELQNEHQQLEERDRRLASAVQKCLELKTSLLARQRGTQSSLD
RLRALLRLIQGEQLLQVTMTTTSPAPLLAGPWTKPSVAATHPTVQHPQGHN
Download sequence
Identical sequences A0A0S2Z6R3 Q96EK2
gi|19923937|ref|NP_612424.1| ENSP00000324403 NP_612424.1.87134 NP_612424.1.92137 ENSP00000324403 ENSP00000324403 9606.ENSP00000324403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]