SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96FE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96FE5
Domain Number 1 Region: 46-379
Classification Level Classification E-value
Superfamily L domain-like 3.63e-60
Family Ngr ectodomain-like 0.0039
Further Details:      
 
Domain Number 2 Region: 432-522
Classification Level Classification E-value
Superfamily Immunoglobulin 2.73e-18
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q96FE5
Sequence length 620
Comment (sp|Q96FE5|LIGO1_HUMAN) Leucine-rich repeat neuronal protein 6A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=LINGO1; OC=Catarrhini; Hominidae; Homo.
Sequence
MQVSKRMLAGGVRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRK
RFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFN
LRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLV
YISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYR
LKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPIS
TIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESVFHSVGN
LETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFT
CRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDG
TLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGE
ANSTRATVPFPFDIKTLIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPR
KSDAGISSADAPRKFNMKMI
Download sequence
Identical sequences G3R4H8 H2R891 Q96FE5
ENSPTRP00000051339 ENSPTRP00000051339 NP_116197.4.87134 NP_116197.4.92137 XP_003314847.1.37143 XP_003811177.1.60992 XP_004056634.1.27298 gi|50263044|ref|NP_116197.4| 9606.ENSP00000347451 ENSP00000347451 ENSP00000347451 ENSP00000347451 NYSGRC-IgSF-LIGO1_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]