SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96FS4 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96FS4
Domain Number 1 Region: 207-546
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 2.62e-104
Family Rap/Ran-GAP 0.000000828
Further Details:      
 
Domain Number 2 Region: 681-761
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000016
Family PDZ domain 0.015
Further Details:      
 
Domain Number 3 Region: 927-1021
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000068
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cell-cell junction 1.461 63.89
apical junction complex 1.901 63.89
occluding junction 2.083 62.59
synapse part 1.419 36.14
cytoplasmic region 1.567 31.58
integral component of plasma membrane 1.428 19.43
plasma membrane receptor complex 1.824 19.43
cell-substrate junction 1.548 18.15
plasma membrane protein complex 1.527 17.72
cell surface 1.3 15.78

Protein sequence

External link(s) Q96FS4
Sequence length 1042
Comment (sp|Q96FS4|SIPA1_HUMAN) p130 SPA-1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SIPA1; OC=Catarrhini; Hominidae; Homo.
Sequence
MPMWAGGVGSPRRGMAPASTDDLFARKLRQPARPPLTPHTFEPRPVRGPLLRSGSDAGEA
RPPTPASPRARAHSHEEASRPAATSTRLFTDPLALLGLPAEEPEPAFPPVLEPRWFAHYD
VQSLLFDWAPRSQGMGSHSEASSGTLASAEDQAASSDLLHGAPGFVCELGGEGELGLGGP
ASPPVPPALPNAAVSILEEPQNRTSAYSLEHADLGAGYYRKYFYGKEHQNFFGMDESLGP
VAVSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVA
PQLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGPAF
MQFLTLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQ
QLLRKRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHTPCTPHTTYRVAVSRT
QDTPAFGPALPAGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLA
TNEVTTTSLDSASRFGLPSLGGRRRAAPRGPGAELQAAGSLVWGVRAAPGARVAAGAQAS
GPEGIEVPCLLGISAEALVLVAPRDGRVVFNCACRDVLAWTFSEQQLDLYHGRGEAITLR
FDGSPGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGFEVDAEGFVTHVERFTFAETA
GLRPGARLLRVCGQTLPSLRPEAAAQLLRSAPKVCVTVLPPDESGRPRRSFSELYTLSLQ
EPSRRGAPDPVQDEVQGVTLLPTTKQLLHLCLQDGGSPPGPGDLAEERTEFLHSQNSLSP
RSSLSDEAPVLPNTTPDLLLATTAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRA
SFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPK
GTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAES
ESAATRLLLASKQLGSPTADLA
Download sequence
Identical sequences K7B4C7 Q96FS4
9606.ENSP00000312246 ENSP00000377771 ENSP00000436269 ENSP00000377774 ENSP00000377771 ENSP00000377774 ENSP00000436269 gi|206725523|ref|NP_006738.3| gi|206725526|ref|NP_694985.29|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]