SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96GQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96GQ7
Domain Number 1 Region: 210-425
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.16e-68
Family Tandem AAA-ATPase domain 0.0000389
Further Details:      
 
Domain Number 2 Region: 362-574
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-48
Family Tandem AAA-ATPase domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q96GQ7
Sequence length 796
Comment (sp|Q96GQ7|DDX27_HUMAN) DEAD box protein 27 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HSPC259, OC=Catarrhini; Hominidae; Homo.
Sequence
MVLAQRRRGGCEKLRAGPQAVLASGSGFCDNMLADLGLIGTIGEDDEVPVEPESDSGDEE
EEGPIVLGRRQKALGKNRSADFNPDFVFTEKEGTYDGSWALADVMSQLKKKRAATTLDEK
IEKVRKKRKTEDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSEDEASETDYSSADE
NILTKADTLKVKDRKKKKKKGQEAGGFFEDASQYDENLSFQDMNLSRPLLKAITAMGFKQ
PTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRE
LGIQVHSVTRQLAQFCNITTCLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSF
HLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLKNP
VRIFVNSNTDVAPFLRQEFIRIRPNREGDREAIVAALLTRTFTDHVMLFTQTKKQAHRMH
ILLGLMGLQVGELHGNLSQTQRLEALRRFKDEQIDILVATDVAARGLDIEGVKTVINFTM
PNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEIVKAAKAPVKARILPQDVILKFR
DKIEKMEKDVYAVLQLEAEEKEMQQSEAQINTAKRLLEKGKEAVVQEPERSWFQTKEERK
KEKIAKALQEFDLALRGKKKRKKFMKDAKKKGEMTAEERSQFEILKAQMFAERLAKRNRR
AKRARAMPEEEPVRGPAKKQKQGKKSVFDEELTNTSKKALKQYRAGPSFEERKQLGLPHQ
RRGGNFKSKSRYKRRK
Download sequence
Identical sequences Q96GQ7
9606.ENSP00000360828 ENSP00000360828 ENSP00000483495 ENSP00000360828 gi|224593278|ref|NP_060365.7| ENSP00000360828 NP_060365.7.87134 NP_060365.7.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]