SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96GY0 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q96GY0
Sequence length 325
Comment (sp|Q96GY0|ZC21A_HUMAN) Zinc finger C2HC domain-containing protein 1A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZC2HC1A; OC=Catarrhini; Hominidae; Homo.
Sequence
MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTD
IPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYI
QCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSP
GTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKP
RNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFC
HECGTKYPVEWAKFCCECGIRRMIL
Download sequence
Identical sequences H2QWB5 Q96GY0
gi|223555989|ref|NP_057094.2| ENSP00000263849 ENSP00000263849 ENSP00000263849 9598.ENSPTRP00000034840 9606.ENSP00000263849 ENSPTRP00000034840 ENSPTRP00000034840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]