SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96HZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96HZ4
Domain Number 1 Region: 90-133
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000314
Family Hairy Orange domain 0.0055
Further Details:      
 
Domain Number 2 Region: 17-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000393
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q96HZ4
Sequence length 224
Comment (sp|Q96HZ4|HES6_HUMAN) Hairy and enhancer of split 6 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HES6 OC=Catarrhini; Hominidae; Homo.
Sequence
MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAK
LENAEVLELTVRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDAT
VAAELLNHLLESMPLREGSSFQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDD
LCSDLEEAPEAELSQAPAEGPDLVPAALGSLTTAQIARSVWRPW
Download sequence
Identical sequences Q96HZ4
ENSP00000272937 ENSP00000272937 ENSP00000272937 gi|21361763|ref|NP_061115.2| NP_061115.2.87134 NP_061115.2.92137 GO.39589 9606.ENSP00000272937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]