SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96IV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q96IV6
Sequence length 333
Comment (sp|Q96IV6|FXDC2_HUMAN) Fatty acid hydroxylase domain-containing protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FAXDC2; OC=Catarrhini; Hominidae; Homo.
Sequence
MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFW
QAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKN
EPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTL
IEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVM
GSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTD
TMFKQTKAYERHVLLLGFTPLSESIPDSPKRME
Download sequence
Identical sequences Q96IV6
9606.ENSP00000320604 ENSP00000320604 gi|146198575|ref|NP_115761.2| NP_115761.2.87134 NP_115761.2.92137 XP_006714816.1.92137 XP_016864454.1.92137 ENSP00000320604 ENSP00000320604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]