SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96KC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96KC8
Domain Number 1 Region: 64-139
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.36e-23
Family Chaperone J-domain 0.00054
Further Details:      
 
Domain Number 2 Region: 495-550
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000218
Family Myb/SANT domain 0.00035
Further Details:      
 
Domain Number 3 Region: 329-379
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000187
Family Myb/SANT domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q96KC8
Sequence length 554
Comment (sp|Q96KC8|DNJC1_HUMAN) DnaJ protein homolog MTJ1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=DNAJC1; OC=Catarrhini; Hominidae; Homo.
Sequence
MTAPCSQPAQLPGRRQLGLVPFPPPPPRTPLLWLLLLLLAAVAPARGWESGDLELFDLVE
EVQLNFYQFLGVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDE
RRQRYDDILINGLPDWRQPVFYYRRVRKMSNAELALLLFIILTVGHYAVVWSIYLEKQLD
ELLSRKKREKKKKTGSKSVDVSKLGASEKNERLLMKPQWHDLLPCKLGIWFCLTLKALPH
LIQDAGQFYAKYKETRLKEKEDALTRTELETLQKQKKVKKPKPEFPVYTPLETTYIQSYD
HGTSIEEIEEQMDDWLENRNRTQKKQAPEWTEEDLSQLTRSMVKFPGGTPGRWEKIAHEL
GRSVTDVTTKAKQLKDSVTCSPGMVRLSELKSTVQNSRPIKTATTLPDDMITQREDAEGV
AAEEEQEGDSGEQETGATDARPRRRKPARLLEATAKPEPEEKSRAKRQKDFDIAEQNESS
DEESLRKERARSAEEPWTQNQQKLLELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYK
LLVELVQKKKQAKS
Download sequence
Identical sequences Q96KC8
ENSP00000366179 ENSP00000366179 gi|21361912|ref|NP_071760.2| 9606.ENSP00000366179 NP_071760.2.87134 NP_071760.2.92137 ENSP00000366145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]