SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96KN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q96KN9
Sequence length 370
Comment (sp|Q96KN9|CXD4_HUMAN) Connexin-40.1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GJD4; OC=Catarrhini; Hominidae; Homo.
Sequence
MEGVDLLGFLIITLNCNVTMVGKLWFVLTMLLRMLVIVLAGRPVYQDEQERFVCNTLQPG
CANVCYDVFSPVSHLRFWLIQGVCVLLPSAVFSVYVLHRGATLAALGPRRCPDPREPASG
QRRCPRPFGERGGLQVPDFSAGYIIHLLLRTLLEAAFGALHYFLFGFLAPKKFPCTRPPC
TGVVDCYVSRPTEKSLLMLFLWAVSALSFLLGLADLVCSLRRRMRRRPGPPTSPSIRKQS
GASGHAEGRRTDEEGGREEEGAPAPPGARAGGEGAGSPRRTSRVSGHTKIPDEDESEVTS
SASEKLGRQPRGRPHREAAQDPRGSGSEEQPSAAPSRLAAPPSCSSLQPPDPPASSSGAP
HLRARKSEWV
Download sequence
Identical sequences Q96KN9
NP_699199.2.87134 NP_699199.2.92137 ENSP00000315070 ENSP00000315070 gi|145699105|ref|NP_699199.2| 9606.ENSP00000315070 ENSP00000315070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]