SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96LR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q96LR7
Sequence length 162
Comment (sp|Q96LR7|CB050_HUMAN) Uncharacterized protein C2orf50 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=C2orf50; OC=Catarrhini; Hominidae; Homo.
Sequence
MGSHPTPGLQRTTSAGYRLPPTRPPASVSPAARGGPMASRGLAGGCQAPQALKAQRVAQG
AACDGVQQDQLWRELLEAERRGQQRWIQNWSFLKDYDPMGNKKEPEKLPDHVPLFSDTVP
SSTNQVVGSRLDTPLGQTLIRMDFFFTEGARKKKLEDQMQPI
Download sequence
Identical sequences Q96LR7
9606.ENSP00000370997 ENSP00000370997 ENSP00000384186 ENSP00000370997 ENSP00000384186 ENSP00000370997 NP_872306.1.87134 NP_872306.1.92137 XP_006711920.1.92137 XP_006711921.1.92137 XP_006711922.1.92137 gi|32698837|ref|NP_872306.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]