SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96M78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q96M78
Sequence length 137
Comment (sp|Q96M78|FEAS2_HUMAN) FER1L6 antisense gene protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FER1L6-AS2; OC=Catarrhini; Hominidae; Homo.
Sequence
MSQVGRVRSSHHFESVCLDAEVRVVLVALDHAGLHTLSSALNESLRPIHREELHLLHFPN
SPEENLRKRPAEPSPQIHGGAPHLPWLCVEKLDLLPENHAVFLQERTAQLFEGSFFFSRS
PAHSISPLLQFRWGHCP
Download sequence
Identical sequences A0A024R9F4 Q96M78
9606.ENSP00000401840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]