SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96MS0 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96MS0
Domain Number 1 Region: 681-865
Classification Level Classification E-value
Superfamily Fibronectin type III 5.89e-26
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 2 Region: 256-353
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-23
Family I set domains 0.0059
Further Details:      
 
Domain Number 3 Region: 450-545
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-22
Family I set domains 0.007
Further Details:      
 
Domain Number 4 Region: 552-655
Classification Level Classification E-value
Superfamily Fibronectin type III 2.33e-22
Family Fibronectin type III 0.0000254
Further Details:      
 
Domain Number 5 Region: 340-441
Classification Level Classification E-value
Superfamily Immunoglobulin 2.53e-22
Family I set domains 0.044
Further Details:      
 
Domain Number 6 Region: 168-262
Classification Level Classification E-value
Superfamily Immunoglobulin 9.61e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 7 Region: 64-163
Classification Level Classification E-value
Superfamily Immunoglobulin 4.6e-17
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
side of membrane 1.633 53.86
external side of plasma membrane 1.923 46.34
axon 1.501 41.37
coated vesicle membrane 2.075 34.75
cell body 1.534 31.5
Golgi-associated vesicle 2.091 30.58
endocytic vesicle 1.532 27.14
Golgi membrane 1.639 26.03
endoplasmic reticulum subcompartment 1.59 21.17
nuclear outer membrane-endoplasmic reticulum membrane network 1.527 20.96

Protein sequence

External link(s) Q96MS0
Sequence length 1386
Comment (sp|Q96MS0|ROBO3_HUMAN) Roundabout-like protein 3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ROBO3; OC=Catarrhini; Hominidae; Homo.
Sequence
MLRYLLKTLLQMNLFADSLAGDISNSSELLLGFNSSLAALNHTLLPPGDPSLNGSRVGPE
DAMPRIVEQPPDLLVSRGEPATLPCRAEGRPRPNIEWYKNGARVATVREDPRAHRLLLPS
GALFFPRIVHGRRARPDEGVYTCVARNYLGAAASRNASLEVAVLRDDFRQSPGNVVVAVG
EPAVLECVPPRGHPEPSVSWRKDGARLKEEEGRITIRGGKLMMSHTLKSDAGMYVCVASN
MAGERESAAAEVMVLERPSFLRRPVNQVVLADAPVTFLCEVKGDPPPRLRWRKEDGELPT
GRYEIRSDHSLWIGHVSAEDEGTYTCVAENSVGRAEASGSLSVHVPPQLVTQPQDQMAAP
GESVAFQCETKGNPPPAIFWQKEGSQVLLFPSQSLQPTGRFSVSPRGQLNITAVQRGDAG
YYVCQAVSVAGSILAKALLEIKGASLDGLPPVILQGPANQTLVLGSSVWLPCRVTGNPQP
SVRWKKDGQWLQGDDLQFKTMANGTLYIANVQEMDMGFYSCVAKSSTGEATWSGWLKMRE
DWGVSPDPPTEPSSPPGAPSQPVVTEITKNSITLTWKPNPQTGAAVTSYVIEAFSPAAGN
TWRTVADGVQLETHTVSGLQPNTIYLFLVRAVGAWGLSEPSPVSEPVRTQDSSPSRPVED
PWRGQQGLAEVAVRLQEPIVLGPRTLQVSWTVDGPVQLVQGFRVSWRVAGPEGGSWTMLD
LQSPSQQSTVLRGLPPGTQIQIKVQAQGQEGLGAESLSVTRSIPEEAPSGPPQGVAVALG
GDGNSSITVSWEPPLPSQQNGVITEYQIWCLGNESRFHLNRSAAGWARSAMLRGLVPGLL
YRTLVAAATSAGVGVPSAPVLVQLPSPPDLEPGLEVGAGLAVRLARVLREPAFLAGSGAA
CGALLLGLCAALYWRRKQRKELSHYTASFAYTPAVSFPHSEGLSGASSRPPMGLGPAPYS
WLADSWPHPSRSPSAQEPRGSCCPSNPDPDDRYYNEAGISLYLAQTARGTAAPGEGPVYS
TIDPAGEELQTFHGGFPQHPSGDLGPWSQYAPPEWSQGDSGAKGGKVKLLGKPVQMPSLN
WPEALPPPPPSCELSCLEGPEEELEGSSEPEEWCPPMPERSHLTEPSSSGGCLVTPSRRE
TPSPTPSYGQQSTATLTPSPPDPPQPPTDMPHLHQMPRRVPLGPSSPLSVSQPMLGIREA
RPAGLGAGPAASPHLSPSPAPSTASSAPGRTWQGNGEMTPPLQGPRARFRKKPKALPYRR
ENSPGDLPPPPLPPPEEEASWALELRAAGSMSSLERERSGERKAVQAVPLAAQRVLHPDE
EAWLPYSRPSFLSRGQGTSTCSTAGSNSSRGSSSSRGSRGPGRSRSRSQSRSQSQRPGQK
RREEPR
Download sequence
Identical sequences Q96MS0
NYSGRC-IgSF-ROBO3_HUMAN 9606.ENSP00000380903 ENSP00000380903 ENSP00000380903 gi|48476182|ref|NP_071765.2| ENSP00000380903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]