SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96N64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96N64
Domain Number 1 Region: 648-744
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.62e-22
Family PWWP domain 0.0093
Further Details:      
 
Weak hits

Sequence:  Q96N64
Domain Number - Region: 66-75
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0523
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q96N64
Sequence length 755
Comment (sp|Q96N64|PWP2A_HUMAN) PWWP domain-containing protein 2A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PWWP2A; OC=Catarrhini; Hominidae; Homo.
Sequence
MAAVAAEAAATAASPGEGGAGEAEPEMEPIPGSEAGTDPLPVTATEASVPDGETDGQQSA
PQADEPPLPPPPPPPGELARSPEAVGPELEAEEKLSVRVAESAAAAPQGGPELPPSPASP
PEQPPAPEEREEPPLPQPVAPALVPPAGGDSTVSQLIPGSEVRVTLDHIIEDALVVSFRF
GEKLFSGVLMDLSKRFGPHGIPVTVFPKREYKDKPEAMPLQSNTFQEGTEVKCEANGAVP
DDPSPVPHPELSLAESLWTSKPPPLFHEGAPYPPPLFIRDTYNQSIPQPPPRKIKRPKRK
MYREEPTSIMNAIKLRPRQVLCDKCKNSVVAEKKEIRKGSSATDSSKYEDKKRRNESVTT
VNKKLKTDHKVDGKNQNESQKRNAVVKVSNIAHSRGRVVKVSAQANTSKAQLSTKKVLQS
KNMDHAKAREVLKIAKEKAQKKQNETSTSKNAHSKVHFTRRYQNPSSGSLPPRVRLKPQR
YRNEENDSSLKTGLEKMRSGKMAPKPQSRCTSTRSAGEAPSENQSPSKGPEEASSEVQDT
NEVHVPGDQDEPQTLGKKGSKNNISVYMTLNQKKSDSSSASVCSIDSTDDLKSSNSECSS
SESFDFPPGSMHAPSTSSTSSSSKEEKKLSNSLKMKVFSKNVSKCVTPDGRTICVGDIVW
AKIYGFPWWPARILTITVSRKDNGLLVRQEARISWFGSPTTSFLALSQLSPFLENFQSRF
NKKRKGLYRKAITEAAKAAKQLTPEVRALLTQFET
Download sequence
Identical sequences Q96N64
ENSP00000305151 9606.ENSP00000305151 ENSP00000390462 NP_001124336.1.87134 NP_001124336.1.92137 gi|195963316|ref|NP_001124336.1| ENSP00000305151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]