SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96N77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96N77
Domain Number 1 Region: 262-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-16
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 104-166
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-16
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 370-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000716
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 300-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000728
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q96N77
Sequence length 438
Comment (sp|Q96N77|ZN641_HUMAN) Zinc finger protein 641 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF641; OC=Catarrhini; Hominidae; Homo.
Sequence
MQAEDRSQFGSAAEMLSEQTAALGTGWESMNVQLDGAEPQVERGSQEERPWRTVPGPLEH
LCCDLEEEPQSLQEKAQSAPWVPAIPQEGNTGDWEMAAALLAAGSQGLVTIKDVSLCFSQ
EEWRSLDPSQTDFYGEYVMQENCGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPQDLEERD
ILRVTYTGDGSEHEGDTPELEAEPPRMLSSVSEDTVLWNPEHDESWDSMPSSSRGMLLGP
PFLQEDSFSNLLCSTEMDSLLRPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKT
FGRRHHLIRHQKTHLHDKTSRCSECGKNFRCNSHLASHQRVHAEGKSCKGQEVGESPGTR
KRQRAPPVPKCHVCTECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLL
THQGQSPRNSWDRGTSVF
Download sequence
Identical sequences Q96N77
9606.ENSP00000301042 ENSP00000301042 ENSP00000437832 ENSP00000301042 gi|289547731|ref|NP_689533.2| NP_689533.2.87134 NP_689533.2.92137 XP_011536199.1.92137 ENSP00000301042 ENSP00000437832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]