SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96PJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96PJ5
Domain Number 1 Region: 292-382
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000108
Family I set domains 0.027
Further Details:      
 
Domain Number 2 Region: 190-282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000469
Family V set domains (antibody variable domain-like) 0.072
Further Details:      
 
Domain Number 3 Region: 106-173
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000016
Family I set domains 0.0081
Further Details:      
 
Domain Number 4 Region: 20-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000204
Family I set domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q96PJ5
Sequence length 515
Comment (sp|Q96PJ5|FCRL4_HUMAN) Immune receptor translocation-associated protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FCRL4; OC=Catarrhini; Hominidae; Homo.
Sequence
MLLWASLLAFAPVCGQSAAAHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWYHR
HYWGEKLTLTPGNTLEVRESGLYRCQARGSPRSNPVRLLFSSDSLILQAPYSVFEGDTLV
LRCHRRRKEKLTAVKYTWNGNILSISNKSWDLLIPQASSNNNGNYRCIGYGDENDVFRSN
FKIIKIQELFPHPELKATDSQPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDW
STYPELQLPTVWRENSGSYWCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQA
VEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCT
ADNSYGPVQSMVLNVTVRETPGNRDGLVAAGATGGLLSALLLAVALLFHCWRRRKSGVGF
LGDETRLPPAPGPGESSHSICPAQVELQSLYVDVHPKKGDLVYSEIQTTQLGEEEEANTS
RTLLEDKDVSVVYSEVKTQHPDNSAGKISSKDEES
Download sequence
Identical sequences Q96PJ5
ENSP00000271532 ENSP00000271532 ENSP00000271532 gi|14550416|ref|NP_112572.1| 9606.ENSP00000271532 NP_112572.1.87134 NP_112572.1.92137 NYSGRC-IgSF-FCRL4_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]