SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96PK6 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96PK6
Domain Number 1 Region: 76-157
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-22
Family Canonical RBD 0.0077
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.14e-17
Family Canonical RBD 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
spliceosomal complex 1.952 53.88
intracellular ribonucleoprotein complex 1.368 46.62
nucleoplasm part 1.369 28.89
small nuclear ribonucleoprotein complex 1.97 27.21
cytoplasmic ribonucleoprotein granule 1.929 21.55
synapse part 1.419 18.59
cytoplasmic region 1.567 10.49
chromosomal part 1.512 7.69
chromatin 1.876 7.69
nuclear chromosome part 1.842 7.69

Protein sequence

External link(s) Q96PK6
Sequence length 669
Comment (sp|Q96PK6|RBM14_HUMAN) Synaptotagmin-interacting protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RBM14; OC=Catarrhini; Hominidae; Homo.
Sequence
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHEL
RPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHME
KEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGG
FSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQ
PSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAAS
SLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRA
AASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQ
QAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASM
GLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASY
RGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSK
RYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQ
MHSGYQRRM
Download sequence
Identical sequences A0A091DZW6 A0A096MNJ6 A0A0S2Z4Z0 G3R212 G7NC47 H2NCQ6 Q96PK6
9600.ENSPPYP00000003492 9606.ENSP00000311747 ENSPANP00000001227 HR4492 gi|5454064|ref|NP_006319.1| ENSP00000311747 ENSP00000311747 ENSGGOP00000009248 ENSP00000311747 ENSPPYP00000003492 ENSPPYP00000003492 ENSGGOP00000009248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]