SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96PP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96PP8
Domain Number 1 Region: 282-574
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 2.88e-105
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.00000000786
Further Details:      
 
Domain Number 2 Region: 7-278
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.64e-67
Family G proteins 0.00000000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q96PP8
Sequence length 586
Comment (sp|Q96PP8|GBP5_HUMAN) Guanine nucleotide-binding protein 5 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GBP5; OC=Catarrhini; Hominidae; Homo.
Sequence
MALEIHMSDPMCLIENFNEQLKVNQEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KNKGFSVASTVQSHTKGIWIWCVPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQIFALAL
LLSSTFVYNTVNKIDQGAIDLLHNVTELTDLLKARNSPDLDRVEDPADSASFFPDLVWTL
RDFCLGLEIDGQLVTPDEYLENSLRPKQGSDQRVQNFNLPRLCIQKFFPKKKCFIFDLPA
HQKKLAQLETLPDDELEPEFVQQVTEFCSYIFSHSMTKTLPGGIMVNGSRLKNLVLTYVN
AISSGDLPCIENAVLALAQRENSAAVQKAIAHYDQQMGQKVQLPMETLQELLDLHRTSER
EAIEVFMKNSFKDVDQSFQKELETLLDAKQNDICKRNLEASSDYCSALLKDIFGPLEEAV
KQGIYSKPGGHNLFIQKTEELKAKYYREPRKGIQAEEVLQKYLKSKESVSHAILQTDQAL
TETEKKKKEAQVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQ
QKMQEQQMQEQAAQLSTTFQAQNRSLLSELQHAQRTVNNDDPCVLL
Download sequence
Identical sequences Q96PP8
9606.ENSP00000340396 ENSP00000359488 gi|16418425|ref|NP_443174.1| gi|197333737|ref|NP_001127958.1| ENSP00000340396 ENSP00000359488 NP_001127958.1.87134 NP_001127958.1.92137 NP_443174.1.87134 NP_443174.1.92137 ENSP00000340396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]