SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96R09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96R09
Domain Number 1 Region: 1-307
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.39e-87
Family Rhodopsin-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q96R09
Sequence length 309
Comment (sp|Q96R09|OR5B2_HUMAN) Olfactory receptor OR11-240 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OR5B2; OC=Catarrhini; Hominidae; Homo.
Sequence
MENCTEVTKFILLGLTSVPELQIPLFILFTFIYLLTLCGNLGMMLLILMDSCLHTPMYFF
LSNLSLVDFGYSSAVTPKVMAGFLRGDKVISYNACAVQMFFFVALATVENYLLASMAYDR
YAAVCKPLHYTTTMTASVGACLALGSYVCGFLNASFHIGGIFSLSFCKSNLVHHFFCDVP
AVMALSCSDKHTSEVILVFMSSFNIFFVLLVIFISYLFIFITILKMHSAKGHQKALSTCA
SHFTAVSVFYGTVIFIYLQPSSSHSMDTDKMASVFYAMIIPMLNPVVYSLRNREVQNAFK
KVLRRQKFL
Download sequence
Identical sequences Q96R09
ENSP00000303076 gi|53933201|ref|NP_001005566.1| ENSP00000303076 ENSP00000303076 NP_001005566.1.87134 NP_001005566.1.92137 9606.ENSP00000303076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]