SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96RK1 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q96RK1
Sequence length 184
Comment (sp|Q96RK1|CITE4_HUMAN) MSG1-related protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CITED4 OC=Catarrhini; Hominidae; Homo.
Sequence
MADHLMLAEGYRLVQRPPSAAAAHGPHALRTLPPYAGPGLDSGLRPRGAPLGPPPPRQPG
ALAYGAFGPPSSFQPFPAVPPPAAGIAHLQPVATPYPGRAAAPPNAPGGPPGPQPAPSAA
APPPPAHALGGMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAG
SVSC
Download sequence
Identical sequences Q96RK1
gi|19263349|ref|NP_597724.1| ENSP00000361721 ENSP00000361721 ENSP00000361721 9606.ENSP00000361721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]