SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96S21 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96S21
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.86e-44
Family G proteins 0.0000221
Further Details:      
 
Domain Number 2 Region: 189-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000785
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 40.37
actin cytoskeleton 1.374 29.03
cilium 1.675 22.42
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
ciliary part 1.819 21.32
chromosomal part 1.512 20.08
midbody 2.182 17.6
side of membrane 1.633 16
nucleoplasm part 1.369 15.74

Protein sequence

External link(s) Q96S21
Sequence length 281
Comment (sp|Q96S21|RB40C_HUMAN) SOCS box-containing protein RAR3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RAB40C; OC=Catarrhini; Hominidae; Homo.
Sequence
MGSQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVP
RILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGM
EKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRS
YSLASGAGGGGSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS
Download sequence
Identical sequences A0A0D9RJR9 A9L8V2 H2NPK4 H2QA75 I2CVA7 Q96S21
ENSPPYP00000007829 ENSPANP00000013464 ENSP00000248139 ENSP00000438382 ENSP00000438492 ENSP00000445050 9598.ENSPTRP00000012882 9600.ENSPPYP00000007829 9606.ENSP00000248139 gi|289547660|ref|NP_066991.3| gi|289547662|ref|NP_001166134.1| gi|289547665|ref|NP_001166135.1| gi|289547667|ref|NP_001166136.1| ENSPTRP00000012882 ENSP00000248139 ENSPTRP00000012882 ENSPPYP00000007829 ENSP00000248139 ENSP00000438382 ENSP00000438492 ENSP00000445050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]