SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96TA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96TA2
Domain Number 1 Region: 332-572
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.22e-67
Family Extended AAA-ATPase domain 0.000000289
Further Details:      
 
Domain Number 2 Region: 589-769
Classification Level Classification E-value
Superfamily FtsH protease domain-like 4.32e-61
Family FtsH protease domain-like 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q96TA2
Sequence length 773
Comment (sp|Q96TA2|YMEL1_HUMAN) YME1-like protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=YME1L1; OC=Catarrhini; Hominidae; Homo.
Sequence
MFSLSSTVQPQVTVPLSHLINAFHTPKNTSVSLSGVSVSQNQHRDVVPEHEAPSSECMFS
DFLTKLNIVSIGKGKIFEGYRSMFMEPAKRMKKSLDTTDNWHIRPEPFSLSIPPSLNLRD
LGLSELKIGQIDQLVENLLPGFCKGKNISSHWHTSHVSAQSFFENKYGNLDIFSTLRSSC
LYRHHSRALQSICSDLQYWPVFIQSRGFKTLKSRTRRLQSTSERLAETQNIAPSFVKGFL
LRDRGSDVESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQALTQKTNDSLRRTRLILFVL
LLFGIYGLLKNPFLSVRFRTTTGLDSAVDPVQMKNVTFEHVKGVEEAKQELQEVVEFLKN
PQKFTILGGKLPKGILLVGPPGTGKTLLARAVAGEADVPFYYASGSEFDEMFVGVGASRI
RNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYSRQTINQLLAEMDGFKPNEGVIIIG
ATNFPEALDNALIRPGRFDMQVTVPRPDVKGRTEILKWYLNKIKFDQSVDPEIIARGTVG
FSGAELENLVNQAALKAAVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHE
SGHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQMDVSMGGRVA
EELIFGTDHITTGASSDFDNATKIAKRMVTKFGMSEKLGVMTYSDTGKLSPETQSAIEQE
IRILLRDSYERAKHILKTHAKEHKNLAEALLTYETLDAKEIQIVLEGKKLEVR
Download sequence
Identical sequences Q96TA2
HR6738 NYSGRC-21327685 gi|21327685|ref|NP_647473.1| ENSP00000365139 NP_647473.1.87134 NP_647473.1.92137 9606.ENSP00000318480 ENSP00000318480 ENSP00000318480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]