SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q99583 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q99583
Domain Number 1 Region: 221-297
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.33e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q99583
Sequence length 582
Comment (sp|Q99583|MNT_HUMAN) Protein ROX KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MNT; OC=Catarrhini; Hominidae; Homo.
Sequence
MSIETLLEAARFLEWQAQQQQRAREEQERLRLEQEREQEQKKANSLARLAHTLPVEEPRM
EAPPLPLSPPAPPPAPPPPLATPAPLTVIPIPVVTNSPQPLPPPPPLPAAAQPLPLAPRQ
PALVGAPGLSIKEPAPLPSRPQVPTPAPLLPDSKATIPPNGSPKPLQPLPTPVLTIAPHP
GVQPQLAPQQPPPPTLGTLKLAPAEEVKSSEQKKRPGGIGTREVHNKLEKNRRAHLKECF
ETLKRNIPNVDDKKTSNLSVLRTALRYIQSLKRKEKEYEHEMERLAREKIATQQRLAELK
HELSQWMDVLEIDRVLRQTGQPEDDQASTSTASEGEDNIDEDMEEDRAGLGPPKLSHRPQ
PELLKSTLPPPSTTPAPLPPHPHPHPHSVALPPAHLPVQQQQPQQKTPLPAPPPPPAAPA
QTLVPAPAHLVATAGGGSTVIAHTATTHASVIQTVNHVLQGPGGKHIAHIAPSAPSPAVQ
LAPATPPIGHITVHPATLNHVAHLGSQLPLYPQPVAVSHIAHTLSHQQVNGTAGLGPPAT
VMAKPAVGAQVVHHPQLVGQTVLNPVTMVTMPSFPVSTLKLA
Download sequence
Identical sequences Q99583
ENSP00000174618 ENSP00000174618 HR4651 NP_064706.1.87134 NP_064706.1.92137 9606.ENSP00000174618 gi|9945318|ref|NP_064706.1| ENSP00000174618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]