SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q99627 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q99627
Domain Number - Region: 129-188
Classification Level Classification E-value
Superfamily PA1123-like 0.0248
Family PA1123-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q99627
Sequence length 209
Comment (sp|Q99627|CSN8_HUMAN) JAB1-containing signalosome subunit 8 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=COPS8; OC=Catarrhini; Hominidae; Homo.
Sequence
MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRI
PPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFAL
VSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFI
PLSEPAPVPPIPNEQQLARLTDYVAFLEN
Download sequence
Identical sequences A0A024R4D1 A0A096NWX9 A0A2I2ZLE6 A0A2K5EX92 A0A2K5M354 A0A2K5Z910 A0A2K6E4B1 A0A2K6UF97 F6TJS7 G1RIN3 G7N990 G7PKD1 K7D2Z8 Q99627
ENSP00000346340 ENSP00000346340 1297 GO.33722 GO.57411 HR1953 NP_006701.1.87134 NP_006701.1.92137 XP_002750001.1.60252 XP_003277511.1.23891 XP_003813157.1.60992 XP_003936796.1.74449 XP_004033462.1.27298 XP_005574778.1.63531 XP_007964952.1.81039 XP_011726276.1.29376 XP_011835678.1.47321 XP_011899248.1.92194 XP_012289580.1.9421 XP_012611168.1.48125 XP_014966886.1.72884 XP_516177.1.37143 ENSCJAP00000004077 gi|5729779|ref|NP_006701.1| ENSCJAP00000048817 9598.ENSPTRP00000042478 9606.ENSP00000346340 ENSP00000346340 ENSPANP00000017569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]